Catalog No: ARP63262_P050-HRP
Size:100ul
Price: $499.00
SKU
ARP63262_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

TPMT Antibody - C-terminal region : HRP (ARP63262_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-TPMT (ARP63262_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Dog, Pig
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 79%; Human: 100%; Pig: 79%
Peptide SequenceSynthetic peptide located within the following region: RGALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPH
Concentration0.5 mg/ml
Blocking PeptideFor anti-TPMT (ARP63262_P050-HRP) antibody is Catalog # AAP63262
Gene SymbolTPMT
Gene Full NameThiopurine S-methyltransferase
Alias SymbolsTPMTD
NCBI Gene Id7172
Protein NameThiopurine S-methyltransferase
Description of TargetThis gene encodes the enzyme that metabolizes thiopurine drugs via S-adenosyl-L-methionine as the S-methyl donor and S-adenosyl-L-homocysteine as a byproduct. Thiopurine drugs such as 6-mercaptopurine are used as chemotherapeutic agents. Genetic polymorphisms that affect this enzymatic activity are correlated with variations in sensitivity and toxicity to such drugs within individuals. A pseudogene for this locus is located on chromosome 18q.
Uniprot IDP51580
Protein Accession #NP_000358
Nucleotide Accession #NM_000367
Protein Size (# AA)245
Molecular Weight27kDa
Protein InteractionsAPP; UBC;
  1. What is the species homology for "TPMT Antibody - C-terminal region : HRP (ARP63262_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Dog, Pig".

  2. How long will it take to receive "TPMT Antibody - C-terminal region : HRP (ARP63262_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TPMT Antibody - C-terminal region : HRP (ARP63262_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TPMT Antibody - C-terminal region : HRP (ARP63262_P050-HRP)"?

    This target may also be called "TPMTD" in publications.

  5. What is the shipping cost for "TPMT Antibody - C-terminal region : HRP (ARP63262_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TPMT Antibody - C-terminal region : HRP (ARP63262_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TPMT Antibody - C-terminal region : HRP (ARP63262_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "27kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TPMT Antibody - C-terminal region : HRP (ARP63262_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TPMT"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TPMT"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TPMT"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TPMT"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TPMT"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TPMT"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TPMT Antibody - C-terminal region : HRP (ARP63262_P050-HRP)
Your Rating
We found other products you might like!