SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP41443_P050
Price: $0.00
SKU
ARP41443_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TPM1 (ARP41443_P050) antibody
Product Info
Tested Species ReactivityHuman, Rat
Predicted Species ReactivityHuman, Mouse, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TPM1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Mouse: 93%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED
Concentration0.5 mg/ml
Blocking PeptideFor anti-TPM1 (ARP41443_P050) antibody is Catalog # AAP41443 (Previous Catalog # AAPP24180)
ReferenceBos,J.M., (2008) Am. Heart J. 155 (6), 1128-1134
Gene SymbolTPM1
Gene Full NameTropomyosin 1 (alpha)
Alias SymbolsCMH3, TMSA, CMD1Y, LVNC9, C15orf13, HEL-S-265, HTM-alpha
NCBI Gene Id7168
Protein NameTropomyosin alpha-1 chain
Description of TargetTPM1 is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha-helical chains arranged as a coiled-coil. It is polymerized end to end along the two grooves of actin filaments and provides stability to the filaments. The protein is one type of alpha helical chain that forms the predominant tropomyosin of striated muscle, where it also functions in association with the troponin complex to regulate the calcium-dependent interaction of actin and myosin during muscle contraction. This gene is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha-helical chains arranged as a coiled-coil. It is polymerized end to end along the two grooves of actin filaments and provides stability to the filaments. The encoded protein is one type of alpha helical chain that forms the predominant tropomyosin of striated muscle, where it also functions in association with the troponin complex to regulate the calcium-dependent interaction of actin and myosin during muscle contraction. In smooth muscle and non-muscle cells, alternatively spliced transcript variants encoding a range of isoforms have been described. Mutations in this gene are associated with type 3 familial hypertrophic cardiomyopathy.
Uniprot IDQ7Z6L8
Protein Accession #NP_001018008
Nucleotide Accession #NM_001018008
Protein Size (# AA)245
Molecular Weight28kDa
Protein InteractionsGOLGA2; CAGE1; C1orf216; SYCE1; KXD1; TFPT; MAD1L1; TPM4; TP53; TNNT1; UBC; MDM2; ETFA; FOXK1; KIAA1598; PPP6R3; APPL2; CDC37; MGEA5; STUB1; ABI2; DNAJC7; HSP90B1; PARK2; LRCH3; PAN2; TGFBR1; SPTBN1; ATF2; MDC1; BRCA1; PPP4R2; SRXN1; NUDCD2; RBM15; THOC2;
  1. What is the species homology for "TPM1 Antibody - middle region (ARP41443_P050)"?

    The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Human, Mouse, Rat".

  2. How long will it take to receive "TPM1 Antibody - middle region (ARP41443_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TPM1 Antibody - middle region (ARP41443_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TPM1 Antibody - middle region (ARP41443_P050)"?

    This target may also be called "CMH3, TMSA, CMD1Y, LVNC9, C15orf13, HEL-S-265, HTM-alpha" in publications.

  5. What is the shipping cost for "TPM1 Antibody - middle region (ARP41443_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TPM1 Antibody - middle region (ARP41443_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TPM1 Antibody - middle region (ARP41443_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "28kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TPM1 Antibody - middle region (ARP41443_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TPM1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TPM1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TPM1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TPM1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TPM1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TPM1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TPM1 Antibody - middle region (ARP41443_P050)
Your Rating
We found other products you might like!