Search Antibody, Protein, and ELISA Kit Solutions

TP73 Antibody - C-terminal region (ARP87125_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
TP73
Official Gene Full Name:
tumor protein p73
NCBI Gene Id:
7161
Protein Name:
Tumor protein p73
Swissprot Id:
O15350-11
Protein Accession #:
NP_001119712.1
Nucleotide Accession #:
NM_001126240.2
Alias Symbols:
P73
Description of Target:
This gene encodes a member of the p53 family of transcription factors involved in cellular responses to stress and development. It maps to a region on chromosome 1p36 that is frequently deleted in neuroblastoma and other tumors, and thought to contain multiple tumor suppressor genes. The demonstration that this gene is monoallelically expressed (likely from the maternal allele), supports the notion that it is a candidate gene for neuroblastoma. Many transcript variants resulting from alternative splicing and/or use of alternate promoters have been found for this gene, but the biological validity and the full-length nature of some variants have not been determined.
Protein Size (# AA):
565
Molecular Weight:
62 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TP73.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TP73.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human TP73
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: NAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRGGPGGGPDEWADFGF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TP73 (ARP87125_P050) antibody is Catalog # AAP87125
Datasheets/Manuals:
Printable datasheet for anti-TP73 (ARP87125_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...