TP73 Antibody - C-terminal region (ARP87125_P050)

Catalog No: ARP87125_P050

Host: Rabbit
Target Name: TP73
Sample Tissue: Human U937 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TP73
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: NAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRGGPGGGPDEWADFGF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TP73 (ARP87125_P050) antibody is Catalog # AAP87125

Target Info

• Gene Symbol: TP73
• Gene Full Name: tumor protein p73
• Alias Symbols: P73
• NCBI Gene Id: 7161
• Protein Name: Tumor protein p73
• Description of Target: This gene encodes a member of the p53 family of transcription factors involved in cellular responses to stress and development. It maps to a region on chromosome 1p36 that is frequently deleted in neuroblastoma and other tumors, and thought to contain multiple tumor suppressor genes. The demonstration that this gene is monoallelically expressed (likely from the maternal allele), supports the notion that it is a candidate gene for neuroblastoma. Many transcript variants resulting from alternative splicing and/or use of alternate promoters have been found for this gene, but the biological validity and the full-length nature of some variants have not been determined.
• Uniprot ID: O15350-11
• Protein Accession #: NP_001119712.1
• Nucleotide Accession #: NM_001126240.2
• Protein Size (# AA): 565
• Molecular Weight: 62 kDa