Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP30370_P050-FITC Conjugated

ARP30370_P050-HRP Conjugated

ARP30370_P050-Biotin Conjugated

TP53 Antibody - N-terminal region (ARP30370_P050)

Catalog#: ARP30370_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ApplicationELISA, WB, CHIP
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-126 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TP53
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-TP53 (ARP30370_P050) antibody is Catalog # AAP30370 (Previous Catalog # AAPS08808)
Datasheets/ManualsPrintable datasheet for anti-TP53 (ARP30370_P050) antibody
Sample Type Confirmation

TP53 is strongly supported by BioGPS gene expression data to be expressed in DU145, HEK293T

TP53 is supported by BioGPS gene expression data to be expressed in HeLa

Target ReferenceBoehme,K.A., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (22), 7785-7790
Gene SymbolTP53
Alias SymbolsLFS1, TRP53, p53
NCBI Gene Id7157
Protein NameCellular tumor antigen p53
Description of TargetTP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity.
Swissprot IdP04637
Protein Accession #NP_000537
Nucleotide Accession #NM_000546
Protein Size (# AA)393
Molecular Weight44kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express TP53.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express TP53.
Write Your Own Review
You're reviewing:TP53 Antibody - N-terminal region (ARP30370_P050)
Your Rating
Aviva Validation Data
Aviva Blast Tool
Aviva ChIP Antibodies
Aviva Travel Grant