Search Antibody, Protein, and ELISA Kit Solutions

TONSL Antibody - C-terminal region : FITC (ARP74997_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74997_P050 Unconjugated

ARP74997_P050-HRP Conjugated

ARP74997_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
TONSL
NCBI Gene Id:
4796
Swissprot Id:
Q96HA7
Protein Accession #:
NP_038460
Alias Symbols:
TONSL, IKBR, NFKBIL2,
Description of Target:
The protein encoded by this gene is thought to be a negative regulator of NF-kappa-B mediated transcription. The encoded protein may bind NF-kappa-B complexes and trap them in the cytoplasm, preventing them from entering the nucleus and interacting with the DNA. Phosphorylation of this protein targets it for degradation by the ubiquitination pathway, which frees the NF-kappa-B complexes to enter the nucleus.
Protein Size (# AA):
1378
Molecular Weight:
151kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TONSL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TONSL.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TONSL
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LTRSRRPRPRGTGDNRRPSSTSGSDSEESRPRARAKQVRLTCMQSCSAPV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
HIST3H3; MCM6; MCM2; MMS22L; ASF1B; ASF1A; UBC; MYC; MAU2; SLC25A5; SUPT16H; SUGT1; AIFM1; HIST1H2BL; XRCC5; SSRP1; SLC25A3; TONSL; MCM4; HIST1H2AE; HIST1H1B; HIST1H1C; XRCC6; GSK3B; MCM7; MCM5; MCM3; EWSR1;
Blocking Peptide:
For anti-TONSL (ARP74997_P050-FITC) antibody is Catalog # AAP74997
Datasheets/Manuals:
Printable datasheet for anti-TONSL (ARP74997_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...