TOMT Antibody - middle region (ARP95252_P050)

Catalog No: ARP95252_P050

Host: Rabbit
Target Name: TOMT
Sample Tissue: Rat Liver lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Rat
• Predicted Species Reactivity: Rat
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of rat TOMT
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: FSYVLTHALPGDPGHILTTLDHWSSCCEYLSHMGPVKGQILMRLVEEKAP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TOMT (ARP95252_P050) antibody is Catalog # AAP95252

Target Info

• Gene Symbol: TOMT
• Gene Full Name: transmembrane O-methyltransferase
• Alias Symbols: Comt, Comt2, F930017I19Rik
• NCBI Gene Id: 791260
• Protein Name: transmembrane O-methyltransferase
• Description of Target: Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones (By similarity). Required for auditory function (By similarity). Component of the cochlear hair cell's mechanotransduction (MET) machinery. Involved in the assembly of the asymmetric tip-link MET complex. Required for transportation of TMC1 and TMC2 proteins into the mechanically sensitive stereocilia of the hair cells. The function in MET is independent of the enzymatic activity (By similarity).
• Uniprot ID: B6CZ62
• Protein Accession #: NP_001075148.1
• Nucleotide Accession #: NM_001081679.1
• Protein Size (# AA): 258
• Molecular Weight: 29 kDa