TNNI3 Antibody - middle region (ARP41391_P050)

Catalog No: ARP41391_P050

Host: Mouse
Target Name: TNNI3
Sample Tissue: Mouse Pancreas
Antibody Dilution: 1ug/ml

Heart

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Paraffin embedded heart tissue, tested with an antibody dilution of 5 ug/ml.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TNNI3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: RVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TNNI3 (ARP41391_P050) antibody is Catalog # AAP41391 (Previous Catalog # AAPP24129)
• Reference: Bos,J.M., (2008) Am. Heart J. 155 (6), 1128-1134
• Publications:

  Measurement of Myofilament-Localized Calcium Dynamics in Adult Cardiomyocytes and the Effect of Hypertrophic Cardiomyopathy Mutations. Circ Res. 124, 1228-1239 (2019). 30732532

• Description:
  View product citations for TNNI3 Antibody - middle region (ARP41391_P050) on CiteAb

Target Info

• Gene Symbol: TNNI3
• Gene Full Name: Troponin I type 3 (cardiac)
• Alias Symbols: CMH7, RCM1, cTnI, CMD2A, TNNC1, CMD1FF
• NCBI Gene Id: 7137
• Protein Name: Serine/threonine-protein kinase TNNI3K
• Description of Target: Troponin I (TnI), along with troponin T (TnT) and troponin C (TnC), is one of 3 subunits that form the troponin complex of the thin filaments of striated muscle. TnI is the inhibitory subunit; blocking actin-myosin interactions and thereby mediating striated muscle relaxation. The TnI subfamily contains three genes: TnI-skeletal-fast-twitch, TnI-skeletal-slow-twitch, and TnI-cardiac. TNNI3 is the TnI-cardiac protein and is exclusively expressed in cardiac muscle tissues.Troponin I (TnI), along with troponin T (TnT) and troponin C (TnC), is one of 3 subunits that form the troponin complex of the thin filaments of striated muscle. TnI is the inhibitory subunit; blocking actin-myosin interactions and thereby mediating striated muscle relaxation. The TnI subfamily contains three genes: TnI-skeletal-fast-twitch, TnI-skeletal-slow-twitch, and TnI-cardiac. This gene encodes the TnI-cardiac protein and is exclusively expressed in cardiac muscle tissues. Mutations in this gene cause familial hypertrophic cardiomyopathy type 7 (CMH7) and familial restrictive cardiomyopathy (RCM). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q59H18
• Protein Accession #: NP_000354
• Nucleotide Accession #: NM_000363
• Protein Size (# AA): 210
• Molecular Weight: 23kDa
• Protein Interactions: TNNC2; TRIM63; TRIM55; RCAN3; TNNC1; TNNI3K; PKD2L1; TNNI3; TNNT2; TNNT1; PRKCA; PAPPA; PKD2; ACTA1; LYST;