Search Antibody, Protein, and ELISA Kit Solutions

TNIP2 Antibody - C-terminal region (ARP88268_P050)

100 ul
In Stock
Request Bulk Order Quote

Gene Symbol:
Official Gene Full Name:
TNFAIP3 interacting protein 2
NCBI Gene Id:
Protein Name:
TNFAIP3-interacting protein 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
This gene encodes a protein which acts as an inhibitor of NFkappaB activation. The encoded protein is also involved in MAP/ERK signaling pathway in specific cell types. It may be involved in apoptosis of endothelial cells. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on the X chromosome.
Protein Size (# AA):
Molecular Weight:
35 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TNIP2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TNIP2.
The immunogen is a synthetic peptide directed towards the C terminal region of human TNIP2
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: DSREPDAGRIHAGSKTAKYLAADALELMVPGGWRPGTGSQQPEPPAEGGH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TNIP2 (ARP88268_P050) antibody is Catalog # AAP88268
Printable datasheet for anti-TNIP2 (ARP88268_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...