Search Antibody, Protein, and ELISA Kit Solutions

TNIP2 Antibody - C-terminal region (ARP88268_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
TNIP2
Official Gene Full Name:
TNFAIP3 interacting protein 2
NCBI Gene Id:
79155
Protein Name:
TNFAIP3-interacting protein 2
Swissprot Id:
Q8NFZ5-2
Protein Accession #:
NP_001154999.1
Nucleotide Accession #:
NM_001161527.1
Alias Symbols:
KLIP, ABIN2, FLIP1
Description of Target:
This gene encodes a protein which acts as an inhibitor of NFkappaB activation. The encoded protein is also involved in MAP/ERK signaling pathway in specific cell types. It may be involved in apoptosis of endothelial cells. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on the X chromosome.
Protein Size (# AA):
322
Molecular Weight:
35 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TNIP2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TNIP2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human TNIP2
Peptide Sequence:
Synthetic peptide located within the following region: DSREPDAGRIHAGSKTAKYLAADALELMVPGGWRPGTGSQQPEPPAEGGH
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TNIP2 (ARP88268_P050) antibody is Catalog # AAP88268
Datasheets/Manuals:
Printable datasheet for anti-TNIP2 (ARP88268_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...