- Tested Species Reactivity:
- Human
- Predicted Species Reactivity:
- Human
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Application:
- WB
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Gene Symbol:
- TNIP2
- Official Gene Full Name:
- TNFAIP3 interacting protein 2
- NCBI Gene Id:
- 79155
- Protein Name:
- TNFAIP3-interacting protein 2
- Swissprot Id:
- Q8NFZ5-2
- Protein Accession #:
- NP_001154999.1
- Nucleotide Accession #:
- NM_001161527.1
- Alias Symbols:
- KLIP, ABIN2, FLIP1
- Description of Target:
- This gene encodes a protein which acts as an inhibitor of NFkappaB activation. The encoded protein is also involved in MAP/ERK signaling pathway in specific cell types. It may be involved in apoptosis of endothelial cells. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on the X chromosome.
- Protein Size (# AA):
- 322
- Molecular Weight:
- 35 kDa
- Purification:
- Affinity purified
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express TNIP2.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express TNIP2.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the C terminal region of human TNIP2
- Peptide Sequence:
- Synthetic peptide located within the following region: DSREPDAGRIHAGSKTAKYLAADALELMVPGGWRPGTGSQQPEPPAEGGH
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Blocking Peptide:
- For anti-TNIP2 (ARP88268_P050) antibody is Catalog # AAP88268
- Datasheets/Manuals:
- Printable datasheet for anti-TNIP2 (ARP88268_P050) antibody
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
