Loading...
Catalog No: AVARP02041_P050
Price: $0.00
SKU
AVARP02041_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TNFSF14 (AVARP02041_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityDog
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TNFSF14
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 92%
Peptide SequenceSynthetic peptide located within the following region: ATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFM
Concentration0.5 mg/ml
Blocking PeptideFor anti-TNFSF14 (AVARP02041_P050) antibody is Catalog # AAP30631 (Previous Catalog # AAPP01284)
Sample Type Confirmation

TNFSF14 is supported by BioGPS gene expression data to be expressed in 721_B

ReferenceKong,M., (er) J. Biomed. Sci. (2008) In press
Gene SymbolTNFSF14
Gene Full NameTumor necrosis factor (ligand) superfamily, member 14
Alias SymbolsLTg, CD258, HVEML, LIGHT
NCBI Gene Id8740
Protein NameTumor necrosis factor ligand superfamily member 14
Description of TargetTNFSF14 is the cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B TNFSF14 modulates its effects. TNFSF14 activates NFKB, stimulates the proliferation of T-cells, and inhibits growth of the adenocarcinoma HT-29. TNFSF14 acts as a receptor for Herpes simplex virus.The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported.
Uniprot IDO43557
Protein Accession #NP_003798
Nucleotide Accession #NM_003807
Protein Size (# AA)240
Molecular Weight22kDa
Protein InteractionsAPP; TNFRSF6B; TNFRSF14; LTBR; LTB; DIABLO; TRAF3; TRAF2; BIRC2;
  1. What is the species homology for "TNFSF14 Antibody - middle region (AVARP02041_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Dog".

  2. How long will it take to receive "TNFSF14 Antibody - middle region (AVARP02041_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TNFSF14 Antibody - middle region (AVARP02041_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TNFSF14 Antibody - middle region (AVARP02041_P050)"?

    This target may also be called "LTg, CD258, HVEML, LIGHT" in publications.

  5. What is the shipping cost for "TNFSF14 Antibody - middle region (AVARP02041_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TNFSF14 Antibody - middle region (AVARP02041_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TNFSF14 Antibody - middle region (AVARP02041_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "22kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TNFSF14 Antibody - middle region (AVARP02041_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TNFSF14"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TNFSF14"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TNFSF14"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TNFSF14"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TNFSF14"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TNFSF14"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TNFSF14 Antibody - middle region (AVARP02041_P050)
Your Rating
We found other products you might like!