TNFSF13B Antibody - N-terminal region : HRP (ARP58542_P050-HRP)

Catalog No: ARP58542_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Horse
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TNFSF13B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Horse: 83%; Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TNFSF13B (ARP58542_P050-HRP) antibody is Catalog # AAP58542 (Previous Catalog # AAPP34539)
• Reference: Xing,X.W., (2003) Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao 35 (3), 283-288

Target Info

• Gene Symbol: TNFSF13B
• Gene Full Name: Tumor necrosis factor (ligand) superfamily, member 13b
• Alias Symbols: DTL, BAFF, BLYS, CD257, TALL1, THANK, ZTNF4, TALL-1, TNLG7A, TNFSF20
• NCBI Gene Id: 10673
• Protein Name: Tumor necrosis factor ligand superfamily member 13B
• Description of Target: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR. This cytokine is expressed in B cell lineage cells, a
• Uniprot ID: Q9Y275
• Protein Accession #: NP_006564
• Nucleotide Accession #: NM_080675
• Protein Size (# AA): 285
• Molecular Weight: 31kDa
• Protein Interactions: TNFRSF13C; TNFRSF13B; TNFSF12; APP; TNFSF13; TNFSF13B; TNFRSF17;