TNFSF12 Recombinant Protein (Human) (OPCA03969)

Catalog No: OPCA03969

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
• Protein Sequence: SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 43-249 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: Crystal structure of human TWEAK in complex with the Fab fragment of a neutralizing antibody reveals insights into receptor binding.Lammens A., Baehner M., Kohnert U., Niewoehner J., von Proff L., Schraeml M., Lammens K., Hopfner K.P.PLoS ONE 8:E62697-E62697(2013)

Target Info

• Gene Symbol: TNFSF12|TNFSF12-TNFSF13
• Gene Full Name: TNF superfamily member 12|TNFSF12-TNFSF13 readthrough
• Alias Symbols: APO3 ligand;APO3/DR3 ligand;APO3L;DR3LG;TNF-related WEAK inducer of apoptosis;TNFSF12-TNFSF13 protein;TNLG4A;tumor necrosis factor (ligand) superfamily, member 12;tumor necrosis factor (ligand) superfamily, member 12-member 13;tumor necrosis factor ligand 4A;tumor necrosis factor ligand superfamily member 12;tumor necrosis factor superfamily member 12;TWEAK;TWE-PRIL.
• NCBI Gene Id: 407977|8742
• Protein Name: Tumor necrosis factor ligand superfamily member 12
• Description of Target: Binds to FN14 and possibly also to TNRFSF12/APO3. Weak inducer of apoptosis in some cell types. Mediates NF-kappa-B activation. Promotes angiogenesis and the proliferation of endothelial cells. Also involved in induction of inflammatory cytokines. Promotes IL8 secretion.
• Uniprot ID: O43508
• Protein Accession #: NP_003800
• Nucleotide Accession #: NM_003809
• Protein Size (# AA): Recombinant
• Molecular Weight: 38.9 kDa