ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: AVARP20005_P050
Price: $0.00
SKU
AVARP20005_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TNFSF12 (AVARP20005_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TNFSF12
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHorse: 93%; Human: 100%; Mouse: 75%
Peptide SequenceSynthetic peptide located within the following region: QEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRA
Concentration0.5 mg/ml
Blocking PeptideFor anti-TNFSF12 (AVARP20005_P050) antibody is Catalog # AAP30630 (Previous Catalog # AAPP01283)
ReferenceJin,L., et al., (2004) J. Invest. Dermatol. 122 (5), 1175-1179
Gene SymbolTNFSF12
Gene Full NameTumor necrosis factor (ligand) superfamily, member 12
Alias SymbolsAPO3L, DR3LG, TWEAK, TNLG4A
NCBI Gene Id8742
Protein NameTumor necrosis factor ligand superfamily member 12
Description of TargetTNFSF12 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is a ligand for the FN14/TWEAKR receptor. This cytokine has overlapping signaling functions with TNF, but displays a much wider tissue distribution. This cytokine can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. This cytokine is also found to promote proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Uniprot IDO43508
Protein Accession #NP_003800
Nucleotide Accession #NM_003809
Protein Size (# AA)249
Molecular Weight27kDa
Protein InteractionsDDIT3; TNFSF13B; LYN; OTUB1; TRAF2; BIRC2; AGGF1; TNFRSF12A; TNFRSF25;
  1. What is the species homology for "TNFSF12 Antibody - N-terminal region (AVARP20005_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Horse".

  2. How long will it take to receive "TNFSF12 Antibody - N-terminal region (AVARP20005_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TNFSF12 Antibody - N-terminal region (AVARP20005_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TNFSF12 Antibody - N-terminal region (AVARP20005_P050)"?

    This target may also be called "APO3L, DR3LG, TWEAK, TNLG4A" in publications.

  5. What is the shipping cost for "TNFSF12 Antibody - N-terminal region (AVARP20005_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TNFSF12 Antibody - N-terminal region (AVARP20005_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TNFSF12 Antibody - N-terminal region (AVARP20005_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "27kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TNFSF12 Antibody - N-terminal region (AVARP20005_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TNFSF12"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TNFSF12"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TNFSF12"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TNFSF12"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TNFSF12"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TNFSF12"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TNFSF12 Antibody - N-terminal region (AVARP20005_P050)
Your Rating
We found other products you might like!