Size:100 ul
$289.00
In Stock
SKU
ARP75210_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP75210_P050 Unconjugated

ARP75210_P050-HRP Conjugated

ARP75210_P050-Biotin Conjugated

TNFSF11 Antibody - C-terminal region : FITC (ARP75210_P050-FITC)

Catalog#: ARP75210_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC (FAM): Excitation 495 nm/ Emission 520 nm
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human TNF11
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: HETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYS
Concentration0.5 mg/ml
Blocking PeptideFor anti-TNFSF11 (ARP75210_P050-FITC) antibody is Catalog # AAP75210
Datasheets/ManualsPrintable datasheet for anti-TNFSF11 (ARP75210_P050-FITC) antibody
Target ReferenceN/A
Gene SymbolTNFSF11
Official Gene Full NameTNF superfamily member 11
Alias SymbolsODF, OPGL, sOdf, CD254, OPTB2, RANKL, TNLG6B, TRANCE, hRANKL2
NCBI Gene Id8600
Protein Nametumor necrosis factor ligand superfamily member 11
Description of TargetThis gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found.
Swissprot IdO14788
Protein Size (# AA)317
Molecular Weight34kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express TNFSF11.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express TNFSF11.
Write Your Own Review
You're reviewing:TNFSF11 Antibody - C-terminal region : FITC (ARP75210_P050-FITC)
Your Rating
Aviva Tips and Tricks
Free Microscope
Aviva Travel Grant
Aviva Blast Tool