Loading...
Catalog No: AVARP02040_P050
Price: $0.00
SKU
AVARP02040_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TNFSF10 (AVARP02040_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Dog, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TNFSF10
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 80%; Human: 100%; Pig: 78%
Peptide SequenceSynthetic peptide located within the following region: CFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETISTVQE
Concentration0.5 mg/ml
Blocking PeptideFor anti-TNFSF10 (AVARP02040_P050) antibody is Catalog # AAP30629 (Previous Catalog # AAPP01282)
ReferenceWu,Y.Y., et al., (2004) World J. Gastroenterol. 10 (16), 2334-2339
Publications

Ceballos, M. P. et al. FoxO3a Nuclear Localization and Its Association with beta-Catenin and Smads in IFN-a-Treated Hepatocellular Carcinoma Cell Lines. J. Interferon Cytokine Res. doi:10.1089/jir.2013.0124 (2014). 24950290

Gene SymbolTNFSF10
Gene Full NameTumor necrosis factor (ligand) superfamily, member 10
Alias SymbolsTL2, APO2L, CD253, TRAIL, Apo-2L, TNLG6A
NCBI Gene Id8743
Protein NameTumor necrosis factor ligand superfamily member 10
Description of TargetTNFSF10 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein preferentially induces apoptosis in transformed and tumor cells, but does not appear to kill normal cells although it is expressed at a significant level in most normal tissues. This protein binds to several members of TNF receptor superfamily including TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and possibly also to TNFRSF11B/OPG. The activity of this protein may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and TNFRSF11B/OPG that cannot induce apoptosis. The binding of this protein to its receptors has been shown to trigger the activation of MAPK8/JNK, caspase 8, and caspase 3.
Uniprot IDP50591
Protein Accession #NP_003801
Nucleotide Accession #NM_003810
Protein Size (# AA)281
Molecular Weight33kDa
Protein InteractionsCASP8; CASP3; CFLAR; TNFRSF10B; FADD; RIPK1; TRAF2; TNFAIP3; SOCS3; RBM48; TNFRSF10D; TNFRSF10C; TNFRSF10A; TNFSF10; TNFRSF11B; ACP5; IER3; CREBBP; SP3; SP1; HDAC5; HDAC4; HDAC3; HDAC2; HDAC1; HIST3H3;
  1. What is the species homology for "TNFSF10 Antibody - N-terminal region (AVARP02040_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Dog, Pig".

  2. How long will it take to receive "TNFSF10 Antibody - N-terminal region (AVARP02040_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TNFSF10 Antibody - N-terminal region (AVARP02040_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TNFSF10 Antibody - N-terminal region (AVARP02040_P050)"?

    This target may also be called "TL2, APO2L, CD253, TRAIL, Apo-2L, TNLG6A" in publications.

  5. What is the shipping cost for "TNFSF10 Antibody - N-terminal region (AVARP02040_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TNFSF10 Antibody - N-terminal region (AVARP02040_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TNFSF10 Antibody - N-terminal region (AVARP02040_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TNFSF10 Antibody - N-terminal region (AVARP02040_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TNFSF10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TNFSF10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TNFSF10"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TNFSF10"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TNFSF10"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TNFSF10"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TNFSF10 Antibody - N-terminal region (AVARP02040_P050)
Your Rating
We found other products you might like!