Size:100 ul
$289.00
In Stock
SKU
ARP74924_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP74924_P050 Unconjugated

ARP74924_P050-HRP Conjugated

ARP74924_P050-Biotin Conjugated

TNFRSF8 Antibody - middle region : FITC (ARP74924_P050-FITC)

Catalog#: ARP74924_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human TNR8
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: PDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVS
Concentration 0.5 mg/ml
Blocking Peptide For anti-TNFRSF8 (ARP74924_P050-FITC) antibody is Catalog # AAP74924
Datasheets/Manuals Printable datasheet for anti-TNFRSF8 (ARP74924_P050-FITC) antibody
Target Reference N/A
Gene Symbol TNFRSF8
Official Gene Full Name TNF receptor superfamily member 8
Alias Symbols CD30, Ki-1, D1S166E
NCBI Gene Id 943
Protein Name tumor necrosis factor receptor superfamily member 8
Description of Target The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Swissprot Id P28908-3
Protein Accession # NP_001268359
Protein Size (# AA) 483
Molecular Weight 53kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TNFRSF8.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TNFRSF8.
Protein Interactions UBC; Traf2; Traf1; TRAF5; TRAF3; TNFRSF8; BCL6; TDP2; TNFSF8; ALK; TRAIP;
  1. What is the species homology for "TNFRSF8 Antibody - middle region : FITC (ARP74924_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "TNFRSF8 Antibody - middle region : FITC (ARP74924_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TNFRSF8 Antibody - middle region : FITC (ARP74924_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TNFRSF8 Antibody - middle region : FITC (ARP74924_P050-FITC)"?

    This target may also be called "CD30, Ki-1, D1S166E" in publications.

  5. What is the shipping cost for "TNFRSF8 Antibody - middle region : FITC (ARP74924_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TNFRSF8 Antibody - middle region : FITC (ARP74924_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TNFRSF8 Antibody - middle region : FITC (ARP74924_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "53kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TNFRSF8 Antibody - middle region : FITC (ARP74924_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "TNFRSF8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TNFRSF8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TNFRSF8"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TNFRSF8"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TNFRSF8"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TNFRSF8"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TNFRSF8 Antibody - middle region : FITC (ARP74924_P050-FITC)
Your Rating
We found other products you might like!