Search Antibody, Protein, and ELISA Kit Solutions

TNFRSF8 Antibody - middle region : FITC (ARP74924_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74924_P050 Unconjugated

ARP74924_P050-HRP Conjugated

ARP74924_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
TNFRSF8
Official Gene Full Name:
TNF receptor superfamily member 8
NCBI Gene Id:
943
Protein Name:
tumor necrosis factor receptor superfamily member 8
Swissprot Id:
P28908-3
Protein Accession #:
NP_001268359
Alias Symbols:
CD30, Ki-1, D1S166E
Description of Target:
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Protein Size (# AA):
483
Molecular Weight:
53kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TNFRSF8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TNFRSF8.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human TNR8
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: PDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
UBC; Traf2; Traf1; TRAF5; TRAF3; TNFRSF8; BCL6; TDP2; TNFSF8; ALK; TRAIP;
Blocking Peptide:
For anti-TNFRSF8 (ARP74924_P050-FITC) antibody is Catalog # AAP74924
Datasheets/Manuals:
Printable datasheet for anti-TNFRSF8 (ARP74924_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...