SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP63782_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TNFRSF1B (ARP63782_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 100%; Guinea Pig: 79%; Horse: 85%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 79%; Rat: 79%
Peptide SequenceSynthetic peptide located within the following region: SDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVAR
Concentration0.5 mg/ml
Blocking PeptideFor anti-TNFRSF1B (ARP63782_P050) antibody is Catalog # AAP63782
Gene SymbolTNFRSF1B
Gene Full NameTumor necrosis factor receptor superfamily, member 1B
Alias Symbolsp75, TBPII, TNFBR, TNFR2, CD120b, TNFR1B, TNFR80, TNF-R75, p75TNFR, TNF-R-II
NCBI Gene Id7133
Protein NameTumor necrosis factor receptor superfamily member 1B
Description of TargetThe protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways.
Uniprot IDP20333
Protein Accession #NP_001057
Nucleotide Accession #NM_001066
Protein Size (# AA)461
Molecular Weight46kDa
  1. What is the species homology for "TNFRSF1B Antibody - N-terminal region (ARP63782_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "TNFRSF1B Antibody - N-terminal region (ARP63782_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TNFRSF1B Antibody - N-terminal region (ARP63782_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "TNFRSF1B Antibody - N-terminal region (ARP63782_P050)"?

    This target may also be called "p75, TBPII, TNFBR, TNFR2, CD120b, TNFR1B, TNFR80, TNF-R75, p75TNFR, TNF-R-II" in publications.

  5. What is the shipping cost for "TNFRSF1B Antibody - N-terminal region (ARP63782_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TNFRSF1B Antibody - N-terminal region (ARP63782_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TNFRSF1B Antibody - N-terminal region (ARP63782_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TNFRSF1B Antibody - N-terminal region (ARP63782_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TNFRSF1B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TNFRSF1B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TNFRSF1B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TNFRSF1B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TNFRSF1B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TNFRSF1B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TNFRSF1B Antibody - N-terminal region (ARP63782_P050)
Your Rating
We found other products you might like!