ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: AVARP00033_T100
Price: $0.00
SKU
AVARP00033_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TNFRSF11B (AVARP00033_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TNFRSF11B
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceDog: 78%; Horse: 78%; Human: 100%; Mouse: 85%; Pig: 78%; Rabbit: 78%; Rat: 78%
Peptide SequenceSynthetic peptide located within the following region: LDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTV
Concentration1.0 mg/ml
Blocking PeptideFor anti-TNFRSF11B (AVARP00033_T100) antibody is Catalog # AAP30520 (Previous Catalog # AAPP01156)
ReferenceCross,S.S., et al., (2006) Int. J. Cancer 118 (8), 1901-1908
Gene SymbolTNFRSF11B
Gene Full NameTumor necrosis factor receptor superfamily, member 11b
Alias SymbolsOPG, TR1, OCIF, PDB5
NCBI Gene Id4982
Protein NameTumor necrosis factor receptor superfamily member 11B
Description of TargetTNFRSF11B is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand (TNFSF11/OPGL), both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart also suggest this protein and its ligand play a role in lymph-node organogenesis and vascular calcification. Alternatively spliced transcript variants of this gene have been reported, but their full length nature has not been determined.
Uniprot IDO00300
Protein Accession #NP_002537
Nucleotide Accession #NM_002546
Protein Size (# AA)401
Molecular Weight46kDa
Protein InteractionsTNFSF13; TNFSF10; TNFSF11; VWF; VTN; THBS1; FN1;
  1. What is the species homology for "TNFRSF11B Antibody - N-terminal region (AVARP00033_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "TNFRSF11B Antibody - N-terminal region (AVARP00033_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TNFRSF11B Antibody - N-terminal region (AVARP00033_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TNFRSF11B Antibody - N-terminal region (AVARP00033_T100)"?

    This target may also be called "OPG, TR1, OCIF, PDB5" in publications.

  5. What is the shipping cost for "TNFRSF11B Antibody - N-terminal region (AVARP00033_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TNFRSF11B Antibody - N-terminal region (AVARP00033_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TNFRSF11B Antibody - N-terminal region (AVARP00033_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TNFRSF11B Antibody - N-terminal region (AVARP00033_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TNFRSF11B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TNFRSF11B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TNFRSF11B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TNFRSF11B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TNFRSF11B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TNFRSF11B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TNFRSF11B Antibody - N-terminal region (AVARP00033_T100)
Your Rating
We found other products you might like!