TNFRSF10C Antibody - N-terminal region (AVARP02039_P050)

Catalog No: AVARP02039_P050

WB Suggested Anti-TNFRSF10C Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Stomach

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TNFRSF10C
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TNFRSF10C (AVARP02039_P050) antibody is Catalog # AAP30623 (Previous Catalog # AAPP01276)

Target Info

• Reference: Inagaki,S., (2007) Biosci. Biotechnol. Biochem. 71 (8), 2065-2068
• Gene Symbol: TNFRSF10C
• Gene Full Name: Tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain
• Alias Symbols: LIT, DCR1, TRID, CD263, TRAILR3, TRAIL-R3, DCR1-TNFR
• NCBI Gene Id: 8794
• Protein Name: Tumor necrosis factor receptor superfamily member 10C
• Description of Target: TNFRSF10C is the receptor for the cytotoxic ligand TRAIL. TNFRSF10C lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. TNFRSF10C may protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand.The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis. This gene was found to be a p53-regulated DNA damage-inducible gene. The expression of this gene was detected in many normal tissues but not in most cancer cell lines, which may explain the specific sensitivity of cancer cells to the apoptosis-inducing activity of TRAIL. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: O14798
• Protein Accession #: NP_003832
• Nucleotide Accession #: NM_003841
• Protein Size (# AA): 259
• Molecular Weight: 25kDa
• Protein Interactions: SRPK2; SRPK1; BMX; FAM101B; LRSAM1; ZHX1; SLC27A6; TNFSF10; APOA1; RAP1A; TP53;