Loading...
Catalog No: AVARP02039_P050
Price: $0.00
SKU
AVARP02039_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TNFRSF10C (AVARP02039_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TNFRSF10C
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKG
Concentration0.5 mg/ml
Blocking PeptideFor anti-TNFRSF10C (AVARP02039_P050) antibody is Catalog # AAP30623 (Previous Catalog # AAPP01276)
ReferenceInagaki,S., (2007) Biosci. Biotechnol. Biochem. 71 (8), 2065-2068
Gene SymbolTNFRSF10C
Gene Full NameTumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain
Alias SymbolsLIT, DCR1, TRID, CD263, TRAILR3, TRAIL-R3, DCR1-TNFR
NCBI Gene Id8794
Protein NameTumor necrosis factor receptor superfamily member 10C
Description of TargetTNFRSF10C is the receptor for the cytotoxic ligand TRAIL. TNFRSF10C lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. TNFRSF10C may protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand.The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis. This gene was found to be a p53-regulated DNA damage-inducible gene. The expression of this gene was detected in many normal tissues but not in most cancer cell lines, which may explain the specific sensitivity of cancer cells to the apoptosis-inducing activity of TRAIL. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDO14798
Protein Accession #NP_003832
Nucleotide Accession #NM_003841
Protein Size (# AA)259
Molecular Weight25kDa
Protein InteractionsSRPK2; SRPK1; BMX; FAM101B; LRSAM1; ZHX1; SLC27A6; TNFSF10; APOA1; RAP1A; TP53;
  1. What is the species homology for "TNFRSF10C Antibody - N-terminal region (AVARP02039_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "TNFRSF10C Antibody - N-terminal region (AVARP02039_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TNFRSF10C Antibody - N-terminal region (AVARP02039_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TNFRSF10C Antibody - N-terminal region (AVARP02039_P050)"?

    This target may also be called "LIT, DCR1, TRID, CD263, TRAILR3, TRAIL-R3, DCR1-TNFR" in publications.

  5. What is the shipping cost for "TNFRSF10C Antibody - N-terminal region (AVARP02039_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TNFRSF10C Antibody - N-terminal region (AVARP02039_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TNFRSF10C Antibody - N-terminal region (AVARP02039_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "25kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TNFRSF10C Antibody - N-terminal region (AVARP02039_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TNFRSF10C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TNFRSF10C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TNFRSF10C"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TNFRSF10C"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TNFRSF10C"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TNFRSF10C"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TNFRSF10C Antibody - N-terminal region (AVARP02039_P050)
Your Rating
We found other products you might like!