Search Antibody, Protein, and ELISA Kit Solutions

TMPO Antibody - N-terminal region (ARP44798_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44798_P050-FITC Conjugated

ARP44798_P050-HRP Conjugated

ARP44798_P050-Biotin Conjugated

Gene Symbol:
TMPO
Official Gene Full Name:
Thymopoietin
NCBI Gene Id:
7112
Protein Name:
Lamina-associated polypeptide 2, isoforms beta/gamma
Swissprot Id:
P42167-2
Protein Accession #:
NP_001027455
Nucleotide Accession #:
NM_001032284
Alias Symbols:
CMD1T, LAP2, MGC61508, PRO0868, TP, LEMD4
Replacement Item:
This antibody may replace item sc-19783 from Santa Cruz Biotechnology.
Description of Target:
TMPO may be involved in the structural organization of the nucleus and in the post-mitotic nuclear assembly. It plays an important role, together with LMNA, in the nuclear anchorage of RB1.
Protein Size (# AA):
345
Molecular Weight:
39kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TMPO.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TMPO.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human TMPO
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-TMPO (ARP44798_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; SUMO3; SPRTN; SUMO1; MDM2; RPA3; RPA2; RPA1; EED; HDAC11; HDAC9; LMNA; CD81; WHSC1; CSNK2A1; FMNL1; YWHAE; SMURF1; PAXIP1; TP53BP1; HP1BP3; BANF1; PFKP; MRE11A; ILF3; CIRBP; FBXO6; USP7; PCGF2; XRCC5; ARRB2; ARRB1; OIP5; SUMO2; RAD21; HDGF; SMARCAD1;
Blocking Peptide:
For anti-TMPO (ARP44798_P050) antibody is Catalog # AAP44798 (Previous Catalog # AAPP12274)
Datasheets/Manuals:
Printable datasheet for anti-TMPO (ARP44798_P050) antibody
Sample Type Confirmation:

TMPO is strongly supported by BioGPS gene expression data to be expressed in SHSY5Y

Target Reference:
Somech,R., (2007) Ann. Hematol. 86 (6), 393-401

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...