Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP44798_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP44798_P050-FITC Conjugated

ARP44798_P050-HRP Conjugated

ARP44798_P050-Biotin Conjugated

TMPO Antibody - N-terminal region (ARP44798_P050)

Catalog#: ARP44798_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-19783 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TMPO
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology dataAnti-TMPO (ARP44798_P050)
Peptide SequenceSynthetic peptide located within the following region: MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-TMPO (ARP44798_P050) antibody is Catalog # AAP44798 (Previous Catalog # AAPP12274)
Datasheets/ManualsPrintable datasheet for anti-TMPO (ARP44798_P050) antibody
Sample Type Confirmation

TMPO is strongly supported by BioGPS gene expression data to be expressed in SHSY5Y

Target ReferenceSomech,R., (2007) Ann. Hematol. 86 (6), 393-401
Gene SymbolTMPO
Official Gene Full NameThymopoietin
Alias SymbolsCMD1T, LAP2, MGC61508, PRO0868, TP, LEMD4
NCBI Gene Id7112
Protein NameLamina-associated polypeptide 2, isoforms beta/gamma
Description of TargetTMPO may be involved in the structural organization of the nucleus and in the post-mitotic nuclear assembly. It plays an important role, together with LMNA, in the nuclear anchorage of RB1.
Swissprot IdP42167-2
Protein Accession #NP_001027455
Nucleotide Accession #NM_001032284
Protein Size (# AA)345
Molecular Weight39kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express TMPO.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express TMPO.
Protein InteractionsUBC; SUMO3; SPRTN; SUMO1; MDM2; RPA3; RPA2; RPA1; EED; HDAC11; HDAC9; LMNA; CD81; WHSC1; CSNK2A1; FMNL1; YWHAE; SMURF1; PAXIP1; TP53BP1; HP1BP3; BANF1; PFKP; MRE11A; ILF3; CIRBP; FBXO6; USP7; PCGF2; XRCC5; ARRB2; ARRB1; OIP5; SUMO2; RAD21; HDGF; SMARCAD1;
Write Your Own Review
You're reviewing:TMPO Antibody - N-terminal region (ARP44798_P050)
Your Rating
Aviva Live Chat
Aviva Travel Grant
Free Microscope
Assay Development