TMOD2 Antibody - N-terminal region : FITC (ARP73179_P050-FITC)

Catalog No: ARP73179_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TMOD2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 79%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 90%; Rabbit: 93%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: TLDPELEEALASASDTELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TMOD2 (ARP73179_P050-FITC) antibody is Catalog # AAP73179

Target Info

• Gene Symbol: TMOD2
• Alias Symbols: NTMOD, N-TMOD
• NCBI Gene Id: 29767
• Description of Target: This gene encodes a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. The encoded protein caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin. Alternatively spliced transcript variants encoding different isoforms have been described.
• Uniprot ID: Q9NZR1
• Protein Size (# AA): 351
• Molecular Weight: 38kDa
• Protein Interactions: UBC; PAN2; SF3B3; SF3B2; SAFB; ABCC1; APP; TPM3; TPM1;