Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP47389_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP47389_P050-FITC Conjugated

ARP47389_P050-HRP Conjugated

ARP47389_P050-Biotin Conjugated

TMEM16K Antibody - C-terminal region (ARP47389_P050)

Catalog#: ARP47389_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-103276 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TMEM16K
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data Anti-TMEM16K (ARP47389_P050)
Peptide Sequence Synthetic peptide located within the following region: LKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ANO10 (ARP47389_P050) antibody is Catalog # AAP47389 (Previous Catalog # AAPP28255)
Datasheets/Manuals Printable datasheet for anti-ANO10 (ARP47389_P050) antibody
Target Reference Ota,T., (2004) Nat. Genet. 36 (1), 40-45
Publications

Hammer, C; Wanitchakool, P; Sirianant, L; Papiol, S; Monnheimer, M; Faria, D; Ousingsawat, J; Schramek, N; Schmitt, C; Margos, G; Michel, A; Kraiczy, P; Pawlita, M; Schreiber, R; Schulz, TF; Fingerle, V; Tumani, H; Ehrenreich, H; Kunzelmann, K; A Coding Variant of ANO10, Affecting Volume Regulation of Macrophages, Is Associated with Borrelia Seropositivity. 21, 26-37 (2015). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 25730773

Schreiber, R; Kunzelmann, K; Expression of anoctamins in retinal pigment epithelium (RPE). 468, 1921-1929 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 27822608

Tian, Y; Schreiber, R; Kunzelmann, K; Anoctamins, a novel family of ion channels and their role in intracellular calcium signaling. 125, 4991-4998 (2015). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22946059

Wanitchakool, P; Ousingsawat, J; Sirianant, L; Cabrita, I; Faria, D; Schreiber, R; Kunzelmann, K; Cellular defects by deletion of ANO10 are due to deregulated local calcium signaling. 30, 41-49 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 27838374

Gene Symbol ANO10
Official Gene Full Name Anoctamin 10
Alias Symbols FLJ10375, MGC47890, SCAR10, TMEM16K
NCBI Gene Id 55129
Protein Name Anoctamin-10
Description of Target TMEM16K is a multi-pass membrane protein. It belongs to the anoctamin family. TMEM16K may act as a calcium-activated chloride channel.
Swissprot Id Q9NW15
Protein Accession # NP_060545
Nucleotide Accession # NM_018075
Protein Size (# AA) 660
Molecular Weight 76kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TMEM16K.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TMEM16K.
Protein Interactions UBC;
  1. What is the species homology for "TMEM16K Antibody - C-terminal region (ARP47389_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "TMEM16K Antibody - C-terminal region (ARP47389_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TMEM16K Antibody - C-terminal region (ARP47389_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TMEM16K Antibody - C-terminal region (ARP47389_P050)"?

    This target may also be called "FLJ10375, MGC47890, SCAR10, TMEM16K" in publications.

  5. What is the shipping cost for "TMEM16K Antibody - C-terminal region (ARP47389_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TMEM16K Antibody - C-terminal region (ARP47389_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TMEM16K Antibody - C-terminal region (ARP47389_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "76kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TMEM16K Antibody - C-terminal region (ARP47389_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ANO10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ANO10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ANO10"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ANO10"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ANO10"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ANO10"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TMEM16K Antibody - C-terminal region (ARP47389_P050)
Your Rating
We found other products you might like!