Search Antibody, Protein, and ELISA Kit Solutions

TMEM16K antibody - C-terminal region (ARP47389_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP47389_P050-FITC Conjugated

ARP47389_P050-HRP Conjugated

ARP47389_P050-Biotin Conjugated

Gene Symbol:
ANO10
NCBI Gene Id:
55129
Official Gene Full Name:
Anoctamin 10
Protein Name:
Anoctamin-10
Swissprot Id:
Q9NW15
Protein Accession #:
NP_060545
Nucleotide Accession #:
NM_018075
Alias Symbols:
FLJ10375, MGC47890, SCAR10, TMEM16K
Replacement Item:
This antibody may replace item sc-103276 from Santa Cruz Biotechnology.
Description of Target:
TMEM16K is a multi-pass membrane protein. It belongs to the anoctamin family. TMEM16K may act as a calcium-activated chloride channel.
Protein Size (# AA):
660
Molecular Weight:
76kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TMEM16K.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TMEM16K.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human TMEM16K
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-TMEM16K (ARP47389_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC;
Blocking Peptide:
For anti-ANO10 (ARP47389_P050) antibody is Catalog # AAP47389 (Previous Catalog # AAPP28255)
Datasheets/Manuals:
Printable datasheet for anti-ANO10 (ARP47389_P050) antibody
Target Reference:
Ota,T., (2004) Nat. Genet. 36 (1), 40-45
Publications:

Tian, Y; Schreiber, R; Kunzelmann, K; Anoctamins, a novel family of ion channels and their role in intracellular calcium signaling. 125, 4991-4998 (2015). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22946059

Hammer, C; Wanitchakool, P; Sirianant, L; Papiol, S; Monnheimer, M; Faria, D; Ousingsawat, J; Schramek, N; Schmitt, C; Margos, G; Michel, A; Kraiczy, P; Pawlita, M; Schreiber, R; Schulz, TF; Fingerle, V; Tumani, H; Ehrenreich, H; Kunzelmann, K; A Coding Variant of ANO10, Affecting Volume Regulation of Macrophages, Is Associated with Borrelia Seropositivity. 21, 26-37 (2015). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 25730773

Schreiber, R; Kunzelmann, K; Expression of anoctamins in retinal pigment epithelium (RPE). 468, 1921-1929 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 27822608

Wanitchakool, P; Ousingsawat, J; Sirianant, L; Cabrita, I; Faria, D; Schreiber, R; Kunzelmann, K; Cellular defects by deletion of ANO10 are due to deregulated local calcium signaling. 30, 41-49 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 27838374

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...