Search Antibody, Protein, and ELISA Kit Solutions

TMEM135 Antibody - N-terminal region (ARP49773_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP49773_P050-FITC Conjugated

ARP49773_P050-HRP Conjugated

ARP49773_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-244355 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM135
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 86%
Complete computational species homology data:
Anti-TMEM135 (ARP49773_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQSASFLTANGALYMAFFC
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TMEM135 (ARP49773_P050) antibody is Catalog # AAP49773 (Previous Catalog # AAPP29349)
Printable datasheet for anti-TMEM135 (ARP49773_P050) antibody
Target Reference:
Suzuki,Y., Gene 200 (1-2), 149-156 (1997)

Lee, WH; Higuchi, H; Ikeda, S; Macke, EL; Takimoto, T; Pattnaik, BR; Liu, C; Chu, LF; Siepka, SM; Krentz, KJ; Rubinstein, CD; Kalejta, RF; Thomson, JA; Mullins, RF; Takahashi, JS; Pinto, LH; Ikeda, A; Mouse Tmem135 mutation reveals a mechanism involving mitochondrial dynamics that leads to age-dependent retinal pathologies. 5, (2016). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 27863209

Gene Symbol:
Official Gene Full Name:
Transmembrane protein 135
Alias Symbols:
DKFZp686I1974, FLJ22104, PMP52
NCBI Gene Id:
Protein Name:
Transmembrane protein 135
Description of Target:
The exact function of TMEM135 remains unknown.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TMEM135.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TMEM135.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...