TMEM106C Antibody - middle region (ARP49796_P050)

Catalog No: ARP49796_P050

WB Suggested Anti-TMEM106C Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Placenta

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Yeast
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMEM106C
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 100%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Mouse: 85%; Rat: 93%; Yeast: 79%
• Peptide Sequence: Synthetic peptide located within the following region: NFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TMEM106C (ARP49796_P050) antibody is Catalog # AAP49796 (Previous Catalog # AAPP29366)
• Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Target Info

• Gene Symbol: TMEM106C
• Gene Full Name: Transmembrane protein 106C
• Alias Symbols: MGC111210, MGC5576
• NCBI Gene Id: 79022
• Protein Name: Transmembrane protein 106C
• Description of Target: It belongs to TMEM106 family. The exact function of TMEM106C remains unknown.
• Uniprot ID: Q9BVX2
• Protein Accession #: NP_076961
• Nucleotide Accession #: NM_024056
• Protein Size (# AA): 250
• Molecular Weight: 28kDa
• Protein Interactions: KRTAP10-3; KRT31; UBC;