TMED2 Antibody - middle region (ARP82862_P050)

Catalog No: ARP82862_P050

Host: Rabbit
Target Name: TMED2
Sample Tissue: Human HepG2 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMED2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: FEVAEGGFLDIDVEITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TMED2 (ARP82862_P050) antibody is Catalog # AAP82862

Target Info

• Gene Symbol: TMED2
• Gene Full Name: transmembrane p24 trafficking protein 2
• Alias Symbols: p24, P24A, RNP24, p24b1, p24beta1
• NCBI Gene Id: 10959
• Protein Name: transmembrane emp24 domain-containing protein 2
• Description of Target: Involved in vesicular protein trafficking. Mainly functions in the early secretory pathway but also in post-Golgi membranes. Thought to act as cargo receptor at the lumenal side for incorporation of secretory cargo molecules into transport vesicles and to be involved in vesicle coat formation at the cytoplasmic side. In COPII vesicle-mediated anterograde transport involved in the transport of GPI-anchored proteins and proposed to act together with TMED10 as their cargo receptor; the function specifically implies SEC24C and SEC24D of the COPII vesicle coat and lipid raft-like microdomains of the ER. Recognizes GPI anchors structural remodeled in the ER by PGAP1 and MPPE1. In COPI vesicle-mediated retrograde transport inhibits the GTPase-activating activity of ARFGAP1 towards ARF1 thus preventing immature uncoating and allowing cargo selection to take place. Involved in trafficking of G protein-coupled receptors (GPCRs). Regulates F2RL1, OPRM1 and P2RY4 exocytic trafficking from the Golgi to the plasma membrane thus contributing to receptor resensitization. Facilitates CASR maturation and stabilization in the early secretory pathway and increases CASR plasma membrane targeting. Proposed to be involved in organization of intracellular membranes such as the maintenance of the Golgi apparatus. May also play a role in the biosynthesis of secreted cargo such as eventual processing.
• Uniprot ID: Q15363
• Protein Accession #: NP_006806.1
• Nucleotide Accession #: NM_006815.3
• Protein Size (# AA): 201
• Molecular Weight: 22 kDa