TMC6 Antibody - N-terminal region (ARP84944_P050)

Catalog No: ARP84944_P050

Host: Rabbit
Target Name: TMC6
Sample Tissue: Human Hela Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMC6
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: TLWRPEGTQSTATLRILASMPSRTIGRSRGAIISQYYNRTVQLRCRSSRP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TMC6 (ARP84944_P050) antibody is Catalog # AAP84944

Target Info

• Gene Symbol: TMC6
• Gene Full Name: transmembrane channel like 6
• Alias Symbols: EV1, lnc, EVER1, EVIN1, LAK-4P, TNRC6C-AS1
• NCBI Gene Id: 11322
• Protein Name: transmembrane channel-like protein 6
• Description of Target: Epidermodysplasia verruciformis (EV) is an autosomal recessive dermatosis characterized by abnormal susceptibility to human papillomaviruses (HPVs) and a high rate of progression to squamous cell carcinoma on sun-exposed skin. EV is caused by mutations in either of two adjacent genes located on chromosome 17q25.3. Both of these genes encode integral membrane proteins that localize to the endoplasmic reticulum and are predicted to form transmembrane channels. This gene encodes a transmembrane channel-like protein with 10 transmembrane domains and 2 leucine zipper motifs.
• Uniprot ID: Q7Z403
• Protein Accession #: NP_001120670.1
• Nucleotide Accession #: NM_001127198.1
• Protein Size (# AA): 805
• Molecular Weight: 88 kDa