Search Antibody, Protein, and ELISA Kit Solutions

TLR2 Antibody - C-terminal region (ARP30551_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP30551_P050-FITC Conjugated

ARP30551_P050-HRP Conjugated

ARP30551_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Toll-like receptor 2
NCBI Gene Id:
Protein Name:
Toll-like receptor 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CD282, TIL4
Replacement Item:
This antibody may replace item sc-10739 from Santa Cruz Biotechnology.
Description of Target:
TLR2 is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is expressed most abundantly in peripheral blood leukocytes, and mediates host response to Gram-positive bacteria and yeast via stimulation of NF-kappaB. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TLR2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TLR2.
The immunogen is a synthetic peptide directed towards the C terminal region of human TLR2
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Sheep, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 91%; Dog: 85%; Goat: 85%; Guinea Pig: 79%; Horse: 92%; Human: 100%; Mouse: 91%; Rat: 92%; Sheep: 91%; Zebrafish: 100%
Complete computational species homology data:
Anti-TLR2 (ARP30551_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-TLR2 (ARP30551_P050) antibody is Catalog # AAP30551 (Previous Catalog # AAPP01203)
Printable datasheet for anti-TLR2 (ARP30551_P050) antibody
Target Reference:
Niebuhr,M., (2008) Allergy 63 (6), 728-734

Schöniger, S; Böttcher, D; Theuß, T; Schoon, HA; Expression of Toll-like receptors 2, 4 and 6 in equine endometrial epithelial cells: A comparative in situ and in vitro study. 112, 34-41 (2017). IF, IHC-FFPE, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Sheep, Zebrafish 28119161

Schöniger, S; Gräfe, H; Schoon, HA; Expression of Toll-like receptors 2, 4 and 6 in different cell populations of the equine endometrium. 185, 7-13 (2017). IF, IHC-FFPE, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Sheep, Zebrafish 28242004

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...