Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP30551_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP30551_P050-FITC Conjugated

ARP30551_P050-HRP Conjugated

ARP30551_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IF, IHC-FFPE, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-10739 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TLR2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 91%; Dog: 85%; Goat: 85%; Guinea Pig: 79%; Horse: 92%; Human: 100%; Mouse: 91%; Rat: 92%; Sheep: 91%; Zebrafish: 100%
Complete computational species homology data Anti-TLR2 (ARP30551_P050)
Peptide Sequence Synthetic peptide located within the following region: LEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-TLR2 (ARP30551_P050) antibody is Catalog # AAP30551 (Previous Catalog # AAPP01203)
Datasheets/Manuals Printable datasheet for anti-TLR2 (ARP30551_P050) antibody
Other Applications Image 1 Data IHC Information: Lung
Target Reference Niebuhr,M., (2008) Allergy 63 (6), 728-734
Other Applications Image 2 Data IHC Information: Human Thymus: Formalin-Fixed, Paraffin-Embedded (FFPE)
Publications

Schöniger, S; Böttcher, D; Theuß, T; Schoon, HA; Expression of Toll-like receptors 2, 4 and 6 in equine endometrial epithelial cells: A comparative in situ and in vitro study. 112, 34-41 (2017). IF, IHC-FFPE, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Sheep, Zebrafish 28119161

Schöniger, S; Gräfe, H; Schoon, HA; Expression of Toll-like receptors 2, 4 and 6 in different cell populations of the equine endometrium. 185, 7-13 (2017). IF, IHC-FFPE, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Sheep, Zebrafish 28242004

Gene Symbol TLR2
Official Gene Full Name Toll-like receptor 2
Alias Symbols CD282, TIL4
NCBI Gene Id 7097
Protein Name Toll-like receptor 2
Description of Target TLR2 is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is expressed most abundantly in peripheral blood leukocytes, and mediates host response to Gram-positive bacteria and yeast via stimulation of NF-kappaB. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id O60603
Protein Accession # NP_003255
Nucleotide Accession # NM_003264
Protein Size (# AA) 784
Molecular Weight 90kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TLR2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TLR2.
Protein Interactions ATG16L1; IRF3; CREBBP; CLEC7A; CLEC4M; TIRAP; MAPK8IP3; TICAM1; TOLLIP; TLR10; TLR6; LY96; RIPK2; TRIP6; MYD88; RAC1; TLR1; IRAK1; HSP90B1; HRAS; SFTPA1; PIK3R1; HMGB1; CD14; TLR2;
Write Your Own Review
You're reviewing:TLR2 Antibody - C-terminal region (ARP30551_P050)
Your Rating