TLE1 Antibody - middle region (ARP97486_P050)

Catalog No: ARP97486_P050

Host: Rabbit
Target Name: TLE1
Sample Tissue: Mouse Brain lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse TLE1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: VPDSLRSTDKRRNGPEFSSDIKKRKVDDKDNYDSDGDKSDDNLVVDVSNE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TLE1 (ARP97486_P050) antibody is Catalog # AAP97486

Target Info

• Gene Symbol: TLE1
• Gene Full Name: transducin-like enhancer of split 1
• Alias Symbols: Grg, Tle, Grg1, Estm1, Grg-1, Tle4l, Estm14, C230057C06Rik
• NCBI Gene Id: 21885
• Protein Name: transducin-like enhancer protein 1
• Description of Target: Transcriptional corepressor that binds to a number of transcription factors. Inhibits NF-kappa-B-regulated gene expression. Inhibits the transcriptional activation mediated by FOXA2, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES. Unusual function as coactivator for ESRRG (By similarity).
• Uniprot ID: Q62440-4
• Protein Accession #: NP_001272459.1
• Nucleotide Accession #: NM_001285530.1
• Protein Size (# AA): 514
• Molecular Weight: 56 kDa