Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TKT antibody - N-terminal region (ARP48540_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
In Stock

Conjugation Options

ARP48540_P050-FITC Conjugated

ARP48540_P050-HRP Conjugated

ARP48540_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
TKT
NCBI Gene Id:
7086
Official Gene Full Name:
Transketolase
Protein Name:
Transketolase
Swissprot Id:
P29401
Protein Accession #:
NP_001055
Nucleotide Accession #:
NM_001064
Alias Symbols:
FLJ34765, TKT1, TK
Description of Target:
TKT belongs to the transketolase family. TKT has been implicated in the latent genetic disease Wernicke-Korsakoff syndrome (WKS), which causes specific brain damage.
Protein Size (# AA):
623
Molecular Weight:
68kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TKT.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TKT.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human TKT
Species Reactivity:
Cow, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Complete computational species homology data:
Anti-TKT (ARP48540_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; FUS; SUMO1; NEDD8; MDM2; FBXO6; SQSTM1; MYC; FN1; UFM1; UFC1; DYNC1LI1; AHCYL1; SSSCA1; VDAC3; UGDH; UBE2I; UBE2D1; TPI1; TALDO1; PKM; PRDX1; IGBP1; MYOC; CUL3; CDK2; ISG15; TERF1; AI837181; Csnk1e; HDAC5; H2AFX; PIK3C2A; ATG5; TKT;
Blocking Peptide:
For anti-TKT (ARP48540_P050) antibody is Catalog # AAP48540 (Previous Catalog # AAPY01484)
Datasheets/Manuals:
Printable datasheet for anti-TKT (ARP48540_P050) antibody
Sample Type Confirmation:

TKT is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Tell us what you think about this item!

Write A Review
    Please, wait...