Search Antibody, Protein, and ELISA Kit Solutions

TKT Antibody - N-terminal region (ARP48540_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP48540_P050-FITC Conjugated

ARP48540_P050-HRP Conjugated

ARP48540_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
The immunogen is a synthetic peptide directed towards the N terminal region of human TKT
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Complete computational species homology data:
Anti-TKT (ARP48540_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TKT (ARP48540_P050) antibody is Catalog # AAP48540 (Previous Catalog # AAPY01484)
Printable datasheet for anti-TKT (ARP48540_P050) antibody
Sample Type Confirmation:

TKT is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Gene Symbol:
Official Gene Full Name:
Alias Symbols:
FLJ34765, TKT1, TK
NCBI Gene Id:
Protein Name:
Description of Target:
TKT belongs to the transketolase family. TKT has been implicated in the latent genetic disease Wernicke-Korsakoff syndrome (WKS), which causes specific brain damage.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TKT.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TKT.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...