Search Antibody, Protein, and ELISA Kit Solutions

TJP1 Antibody - middle region (ARP36636_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP36636_P050-FITC Conjugated

ARP36636_P050-HRP Conjugated

ARP36636_P050-Biotin Conjugated

Gene Symbol:
TJP1
Official Gene Full Name:
Tight junction protein 1 (zona occludens 1)
NCBI Gene Id:
7082
Protein Name:
Tight junction protein ZO-1
Swissprot Id:
Q07157
Protein Accession #:
NP_783297
Nucleotide Accession #:
NM_175610
Alias Symbols:
DKFZp686M05161, MGC133289, ZO-1
Replacement Item:
This antibody may replace item sc-10804 from Santa Cruz Biotechnology.
Description of Target:
TJP1 is a protein located on a cytoplasmic membrane surface of intercellular tight junctions. TJP1 may be involved in signal transduction at cell-cell junctions.This gene encodes a protein located on a cytoplasmic membrane surface of intercellular tight junctions. The encoded protein may be involved in signal transduction at cell-cell junctions. Two transcript variants encoding distinct isoforms have been identified for this gene.
Protein Size (# AA):
1668
Molecular Weight:
187kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TJP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TJP1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human TJP1
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Dog: 92%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 87%; Pig: 93%; Rabbit: 100%; Rat: 93%
Complete computational species homology data:
Anti-TJP1 (ARP36636_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
VMP1; RAPGEF2; LATS2; TJP2; PAN2; DTNA; UBC; SCO2; VAPA; VAPB; ZPR1; NOTCH2; NDUFV2; NDUFS6; SUGP1; RTN4; STRN; PARD3; PARD6A; PRKCI; SIRT7; KHDRBS1; ELAVL1; SSTR3; Cdk1; TUBA1C; TUBB4A; VIM; SPTAN1; PLEC; KRT10; KRT8; KRT1; GJA1; FLNA; ANXA6; ACTN1; ACTN
Blocking Peptide:
For anti-TJP1 (ARP36636_P050) antibody is Catalog # AAP36636 (Previous Catalog # AAPP07874)
Datasheets/Manuals:
Printable datasheet for anti-TJP1 (ARP36636_P050) antibody
Additional Information:
IHC Information: Paraffin embedded testis tissue, tested with an antibody dilution of 5 ug/ml.
Target Reference:
Shen,L., (2008) J. Cell Biol. 181 (4), 683-695

Product Reviews

Average Rating:
1 review
5 star
1
4 star
0
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

122/05/2019 23:27
  • Overall Experience:
  • Quality:
Human brain (frozen sections) in IF

Submitted by:
Itzik Cooper
Sagol Neuroscience Center

TJP

1. Species and tissue/cell type used: Human Brain (frozen sections)
2. Primary antibody dilution: 1:500

3. Stain/counterstain: Fluorescein Lectin as a marker for blood vessels. Wide arrow: unspecific staining. (probably neurons). Narrow arrows: specific staining of ZO-1 in blood vessels.

0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...