TIMP1 Recombinant Protein (Rat) (OPCA01119)

Catalog No: OPCA01119

Product Info

• Predicted Species Reactivity: Rat|Rattus norvegicus
• Product Format: Liquid or Lyophilized powder
• Additional Information: Tag information : His tag
  
• Reconstitution and Storage: -20°C or -80°C
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: CSCAPTHPQTAFCNSDLVIRAKFMGSPEIIETTLYQRYEIKMTKMLKGFDAVGNATGFRFAYTPAMESLCGYVHKSQNRSEEFLIAGRLRNGNLHITACSFLVPWHNLSPAQQKAFVKTYSAGCGVCTVFPCSAIPCKLESDSHCLWTDQILMGSEKGYQSDHFACLPRNPDLCTWQYLGVSMTRSLPLAKAEA
• Protein Sequence: CSCAPTHPQTAFCNSDLVIRAKFMGSPEIIETTLYQRYEIKMTKMLKGFDAVGNATGFRFAYTPAMESLCGYVHKSQNRSEEFLIAGRLRNGNLHITACSFLVPWHNLSPAQQKAFVKTYSAGCGVCTVFPCSAIPCKLESDSHCLWTDQILMGSEKGYQSDHFACLPRNPDLCTWQYLGVSMTRSLPLAKAEA
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 24-217 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Purification and sequence analysis of two rat tissue inhibitors of metalloproteinases.Roswit W.T., McCourt D.W., Partridge N.C., Jeffrey J.J.Arch. Biochem. Biophys. 292:402-410(1992)
• Gene Symbol: Timp1
• Gene Full Name: TIMP metallopeptidase inhibitor 1
• Alias Symbols: metalloproteinase inhibitor 1;Timp;TIMP-1;tissue inhibitor of metallopeptidase 1;tissue inhibitor of metalloproteinase 1;tissue inhibitor of metalloproteinases 1.
• NCBI Gene Id: 116510
• Protein Name: Metalloproteinase inhibitor 1
• Description of Target: Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. Also stimulates steroidogenesis by Leydig and ovarian granuloma cells; procathepsin L is required for maximal activity.
• Uniprot ID: P30120
• Protein Size (# AA): Recombinant
• Molecular Weight: 25.5 kDa