SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP38404_T100
Price: $0.00
SKU
ARP38404_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TIMELESS (ARP38404_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Sheep, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human TIMELESS
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 83%; Horse: 83%; Human: 100%; Mouse: 90%; Rat: 100%; Sheep: 100%; Yeast: 91%
Peptide SequenceSynthetic peptide located within the following region: EEEDAVGKEPLKAAPKKRQLLDSDEEQEEDEGRNRAPELGAPGIQKKKRY
Concentration1.0 mg/ml
Blocking PeptideFor anti-TIMELESS (ARP38404_T100) antibody is Catalog # AAP38404 (Previous Catalog # AAPP20590)
ReferenceSangoram,A.M., (2005) Mol. Cell. Biol. 25 (8), 3109-3116
Gene SymbolTIMELESS
Gene Full NameTimeless homolog (Drosophila)
Alias SymbolsTIM, TIM1, hTIM
NCBI Gene Id8914
Protein NameProtein timeless homolog
Description of TargetThe human Timeless protein interacts with both the circadian clock protein cryptochrome 2 and with the cell cycle checkpoint proteins Chk1 and the ATR-ATRIP complex and plays an important role in the DNA damage checkpoint response. Down-regulation of Timeless in human cells seriously compromises replication and intra-S checkpoints, indicating an intimate connection between the circadian cycle and the DNA damage checkpoints that is in part mediated by the Timeless protein.
Uniprot IDQ9UNS1
Protein Accession #NP_003911
Nucleotide Accession #NM_003920
Protein Size (# AA)1208
Molecular Weight139kDa
Protein InteractionsUBC; TUT1; TF; XRCC1; FKBP3; SP1; SUMO2; Tipin; Timeless; ZSCAN1; PCBD1; CRY1; PER2; PER1; CLSPN; PCNA; per; Clock; ATRIP; CRY2; CHEK1;
  1. What is the species homology for "TIMELESS Antibody - C-terminal region (ARP38404_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Sheep, Yeast".

  2. How long will it take to receive "TIMELESS Antibody - C-terminal region (ARP38404_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TIMELESS Antibody - C-terminal region (ARP38404_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TIMELESS Antibody - C-terminal region (ARP38404_T100)"?

    This target may also be called "TIM, TIM1, hTIM" in publications.

  5. What is the shipping cost for "TIMELESS Antibody - C-terminal region (ARP38404_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TIMELESS Antibody - C-terminal region (ARP38404_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TIMELESS Antibody - C-terminal region (ARP38404_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "139kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TIMELESS Antibody - C-terminal region (ARP38404_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TIMELESS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TIMELESS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TIMELESS"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TIMELESS"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TIMELESS"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TIMELESS"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TIMELESS Antibody - C-terminal region (ARP38404_T100)
Your Rating
We found other products you might like!