TIGD4 Antibody - N-terminal region : HRP (ARP52857_P050-HRP)

Catalog No: ARP52857_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TIGD4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TIGD4 (ARP52857_P050-HRP) antibody is Catalog # AAP52857 (Previous Catalog # AAPP33914)

Target Info

• Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
• Gene Symbol: TIGD4
• Gene Full Name: Tigger transposable element derived 4
• Alias Symbols: MGC43837
• NCBI Gene Id: 201798
• Protein Name: Tigger transposable element-derived protein 4
• Description of Target: The specific function of the protein remains unknown.The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this gene is not known.
• Uniprot ID: Q8IY51
• Protein Accession #: NP_663772
• Nucleotide Accession #: NM_145720
• Protein Size (# AA): 512
• Molecular Weight: 57kDa
• Protein Interactions: HOXD4;