TIGD1 Antibody - middle region (ARP52855_P050)

Catalog No: ARP52855_P050

WB Suggested Anti-TIGD1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: ACHN cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Dog, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TIGD1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 85%; Horse: 100%; Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SQLMRKASPMSYFRKLPQPPQPSAATTLTSQQPSTSRQDPPPAKRVRLTE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TIGD1 (ARP52855_P050) antibody is Catalog # AAP52855 (Previous Catalog # AAPP33912)
• Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731

Target Info

• Gene Symbol: TIGD1
• Gene Full Name: Tigger transposable element derived 1
• Alias Symbols: EEYORE
• NCBI Gene Id: 200765
• Protein Name: Tigger transposable element-derived protein 1
• Description of Target: TIGD1 belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this protein is not known.The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this gene is not known.
• Uniprot ID: Q96MW7
• Protein Accession #: NP_663748
• Nucleotide Accession #: NM_145702
• Protein Size (# AA): 591
• Molecular Weight: 67kDa
• Protein Interactions: APP;