Search Antibody, Protein, and ELISA Kit Solutions

TIA1 Antibody - C-terminal region (ARP40981_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP40981_P050-FITC Conjugated

ARP40981_P050-HRP Conjugated

ARP40981_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, IP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-166246 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human TIA1
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 82%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 93%
Complete computational species homology data:
Anti-TIA1 (ARP40981_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TIA1 (ARP40981_P050) antibody is Catalog # AAP40981 (Previous Catalog # AAPP22795)
Datasheets/Manuals:
Printable datasheet for anti-TIA1 (ARP40981_P050) antibody
Target Reference:
Lopez (2005) Mol. Cell. Biol. 25 (21), 9520-9531
Gene Symbol:
TIA1
Official Gene Full Name:
TIA1 cytotoxic granule-associated RNA binding protein
Alias Symbols:
TIA-1
NCBI Gene Id:
7072
Protein Name:
Nucleolysin TIA-1 isoform p40
Description of Target:
TIA1 is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognizes poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15-kDa protein that is thought to be derived from the carboxyl terminus of the 40-kDa product by proteolytic processing.The product encoded by this gene is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognizes poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15-kDa protein that is thought to be derived from the carboxyl terminus of the 40-kDa product by proteolytic processing. Alternative splicing resulting in different isoforms of this gene product has been described in the literature.
Swissprot Id:
P31483-2
Protein Accession #:
NP_071320
Nucleotide Accession #:
NM_022037
Protein Size (# AA):
375
Molecular Weight:
42kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TIA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TIA1.
Protein Interactions:
NEDD8; BMI1; SOX2; VCAM1; ITGA4; FN1; FMNL1; WDR6; SRSF3; CAND1; DCUN1D1; COPS5; CUL1; CUL2; CUL3; CUL4A; CUL5; Rc3h1; UBC; RICTOR; FASTK;

Product Reviews

Average Rating:
1 review
5 star
1
4 star
0
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

122/05/2019 23:00
  • Overall Experience:
  • Quality:
Human Fibroblasts in WB

Submitted by:
Elisabetta Morini
Harvard University

TIA1
“It works well for WB”

Sample type: Human fibroblast
Lane 1: 20ug human fibroblast
Lane 2: 20ug human fibroblast

Primary antibody dilution: 1:1000

Secondary antibody and dilution: 1:5000

0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...