SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP54988_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

THYN1 Antibody - middle region (ARP54988_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-THYN1 (ARP54988_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human THYN1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 93%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Peptide SequenceSynthetic peptide located within the following region: NPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLK
Concentration0.5 mg/ml
Blocking PeptideFor anti-THYN1 (ARP54988_P050) antibody is Catalog # AAP54988 (Previous Catalog # AAPP32249)
ReferenceSong,A.X., (2005) Protein Expr. Purif. 42 (1), 146-152
Gene SymbolTHYN1
Gene Full NameThymocyte nuclear protein 1
Alias SymbolsMY105, THY28, MDS012, HSPC144, THY28KD
NCBI Gene Id29087
Protein NameThymocyte nuclear protein 1
Description of TargetTHYN1 is a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis.This gene encodes a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described.
Uniprot IDQ9P016
Protein Accession #NP_054893
Nucleotide Accession #NM_014174
Protein Size (# AA)225
Molecular Weight26kDa
Protein InteractionsUBC; THOC2; PRKDC; TFAP4;
  1. What is the species homology for "THYN1 Antibody - middle region (ARP54988_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "THYN1 Antibody - middle region (ARP54988_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "THYN1 Antibody - middle region (ARP54988_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "THYN1 Antibody - middle region (ARP54988_P050)"?

    This target may also be called "MY105, THY28, MDS012, HSPC144, THY28KD" in publications.

  5. What is the shipping cost for "THYN1 Antibody - middle region (ARP54988_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "THYN1 Antibody - middle region (ARP54988_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "THYN1 Antibody - middle region (ARP54988_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "26kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "THYN1 Antibody - middle region (ARP54988_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "THYN1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "THYN1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "THYN1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "THYN1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "THYN1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "THYN1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:THYN1 Antibody - middle region (ARP54988_P050)
Your Rating