Search Antibody, Protein, and ELISA Kit Solutions

THY1 Antibody - N-terminal region : FITC (ARP74283_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74283_P050 Unconjugated

ARP74283_P050-HRP Conjugated

ARP74283_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Protein Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-159201 from Santa Cruz Biotechnology.
Description of Target:
THY1 may play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express THY1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express THY1.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human THY1
Peptide Sequence:
Synthetic peptide located within the following region: TVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-THY1 (ARP74283_P050-FITC) antibody is Catalog # AAP74283
Printable datasheet for anti-THY1 (ARP74283_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...