Now Offering Over 102,157 Antibodies & 44,722 Antigens!

THRA antibody - middle region (ARP34780_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP34780_P050-FITC Conjugated

ARP34780_P050-HRP Conjugated

ARP34780_P050-Biotin Conjugated

Gene Symbol:
THRA
NCBI Gene Id:
7067
Official Gene Full Name:
Thyroid hormone receptor, alpha
Protein Name:
Thyroid hormone receptor alpha
Swissprot Id:
P10827
Protein Accession #:
NP_003241
Nucleotide Accession #:
NM_003250
Alias Symbols:
AR7, EAR7, ERB-T-1, ERBA, ERBA1, MGC000261, MGC43240, NR1A1, THRA1, THRA2, c-ERBA-1, CHNG6
Replacement Item:
This antibody may replace item sc-10819 from Santa Cruz Biotechnology.
Description of Target:
The THRA gene encodes a protein that is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone.
Protein Size (# AA):
490
Molecular Weight:
55kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express THRA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express THRA.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human THRA
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-THRA (ARP34780_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
L3MBTL3; AMOTL2; RANBP9; NCOR1; PTGES3; THRA; RXRA; FOXJ1; CLIC1; C1D; NCOR2; BUB3; tat; GTF2B; ARID5A; SUMO1; SUMO3; MED1; NRIP1; MED21; CDK7; MED25; RGN; CUL1; SEPP1; TBL1XR1; HDAC3; SMC1A; XRCC5; TBL1X; PRKDC; LIG3; HSPA4; GPS2; XRCC6; PARP1; EMD; GRIP
Blocking Peptide:
For anti-THRA (ARP34780_P050) antibody is Catalog # AAP34780 (Previous Catalog # AAPP05974)
Datasheets/Manuals:
Printable datasheet for anti-THRA (ARP34780_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that THRA is expressed in Jurkat

Publications:

Kiss-Toth, E., Harlock, E., Lath, D., Quertermous, T. & Wilkinson, J. M. A TNF variant that associates with susceptibility to musculoskeletal disease modulates thyroid hormone receptor binding to control promoter activation. PLoS One 8, e76034 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 24069456

Tell us what you think about this item!

Write A Review
    Please, wait...