Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP67324_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP67324_P050-FITC Conjugated

ARP67324_P050-HRP Conjugated

ARP67324_P050-Biotin Conjugated

THOC7 Antibody - C-terminal region (ARP67324_P050)

Catalog#: ARP67324_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-103072 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human THOC7
PurificationAffinity purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Pig: 93%; Rabbit: 79%; Rat: 79%
Complete computational species homology dataAnti-THOC7 (ARP67324_P050)
Peptide SequenceSynthetic peptide located within the following region: SVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-THOC7 (ARP67324_P050) antibody is Catalog # AAP67324
Datasheets/ManualsPrintable datasheet for anti-THOC7 (ARP67324_P050) antibody
Target ReferenceN/A
Gene SymbolTHOC7
Official Gene Full NameTHO complex 7 homolog (Drosophila)
Alias SymbolsTHOC7, NIF3L1BP1,
NCBI Gene Id80145
Protein NameTHO complex subunit 7 homolog
Description of TargetTHOC7 is required for efficient export of polyadenylated RNA. It acts as component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and which specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production.
Swissprot IdQ6I9Y2
Protein Accession #NP_079351
Protein Size (# AA)204
Molecular Weight22kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express THOC7.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express THOC7.
Protein InteractionsTHOC2; RPA3; RPA2; RPA1; CKAP4; UBC; ZC3H15; TRMT112; PPIP5K2; THOC1; UBE3C; USP13; ZPR1; THOC5; VIM; S100A13; WDR36; ZCRB1; THOC3; ZNF606; THOC6; ALYREF; DDX39B; NIF3L1; CHD3; MED8; GOT2; MED18; MED22;
  1. What is the species homology for "THOC7 Antibody - C-terminal region (ARP67324_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat".

  2. How long will it take to receive "THOC7 Antibody - C-terminal region (ARP67324_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "THOC7 Antibody - C-terminal region (ARP67324_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "THOC7 Antibody - C-terminal region (ARP67324_P050)"?

    This target may also be called "THOC7, NIF3L1BP1, " in publications.

  5. What is the shipping cost for "THOC7 Antibody - C-terminal region (ARP67324_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "THOC7 Antibody - C-terminal region (ARP67324_P050)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "THOC7 Antibody - C-terminal region (ARP67324_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "22kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "THOC7 Antibody - C-terminal region (ARP67324_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "THOC7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "THOC7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "THOC7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "THOC7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "THOC7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "THOC7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:THOC7 Antibody - C-terminal region (ARP67324_P050)
Your Rating
Aviva ChIP Antibodies
Aviva Blast Tool
Aviva Tissue Tool
Aviva Travel Grant