Search Antibody, Protein, and ELISA Kit Solutions

THOC7 Antibody - C-terminal region (ARP67324_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP67324_P050-FITC Conjugated

ARP67324_P050-HRP Conjugated

ARP67324_P050-Biotin Conjugated

Gene Symbol:
THOC7
Official Gene Full Name:
THO complex 7 homolog (Drosophila)
NCBI Gene Id:
80145
Protein Name:
THO complex subunit 7 homolog
Swissprot Id:
Q6I9Y2
Protein Accession #:
NP_079351
Alias Symbols:
THOC7, NIF3L1BP1,
Replacement Item:
This antibody may replace item sc-103072 from Santa Cruz Biotechnology.
Description of Target:
THOC7 is required for efficient export of polyadenylated RNA. It acts as component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and which specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production.
Protein Size (# AA):
204
Molecular Weight:
22kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express THOC7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express THOC7.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human THOC7
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Pig: 93%; Rabbit: 79%; Rat: 79%
Complete computational species homology data:
Anti-THOC7 (ARP67324_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
THOC2; RPA3; RPA2; RPA1; CKAP4; UBC; ZC3H15; TRMT112; PPIP5K2; THOC1; UBE3C; USP13; ZPR1; THOC5; VIM; S100A13; WDR36; ZCRB1; THOC3; ZNF606; THOC6; ALYREF; DDX39B; NIF3L1; CHD3; MED8; GOT2; MED18; MED22;
Blocking Peptide:
For anti-THOC7 (ARP67324_P050) antibody is Catalog # AAP67324
Datasheets/Manuals:
Printable datasheet for anti-THOC7 (ARP67324_P050) antibody
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...