Catalog No: AVARP01052_P050-FITC
Size:100ul
Price: $434.00
SKU
AVARP01052_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

TH Antibody - N-terminal region : FITC (AVARP01052_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-TH (AVARP01052_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the n terminal region of human TH
Predicted Homology Based on Immunogen SequenceCow: 90%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: MPTPDATTPQAKGFRRAVSELDAKQAEAIMVRGQSPRFIGRRQSLIEDAR
Concentration0.5 mg/ml
Blocking PeptideFor anti-TH (AVARP01052_P050-FITC) antibody is Catalog # AAP30545 (Previous Catalog # AAPP01181)
ReferenceThis antibody produces strong specific staining in both rat and mouse brain as expected. Recommended dilution: 1:100-1:1000. Antibody can be applied to both paraffin and frozen tissue
Gene SymbolTH
Gene Full NameTyrosine hydroxylase
Alias SymbolsTYH, DYT14, DYT5b
NCBI Gene Id7054
Protein NameTyrosine 3-monooxygenase Ensembl ENSP00000328814
Description of TargetPlays an important role in the physiology of adrenergic neurons. Tyrosine hydroxylase is involved in the conversion of tyrosine to dopamine. As the rate-limiting enzyme in the synthesis of catecholamines, tyrosine hydroxylase has a key role in the physiology of adrenergic neurons.
Uniprot IDQ0PWM2
Protein Size (# AA)407
Molecular Weight45kDa
Protein InteractionsTYSND1; YWHAQ; MAPKAPK2; CDK11B; RPS6KA5; CAMK2G; MAPK3; PRKACA; YWHAB; YWHAZ; MAPK1; SNCA; CSNK2A1;
  1. What is the species homology for "TH Antibody - N-terminal region : FITC (AVARP01052_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Rabbit, Zebrafish".

  2. How long will it take to receive "TH Antibody - N-terminal region : FITC (AVARP01052_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TH Antibody - N-terminal region : FITC (AVARP01052_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TH Antibody - N-terminal region : FITC (AVARP01052_P050-FITC)"?

    This target may also be called "TYH, DYT14, DYT5b" in publications.

  5. What is the shipping cost for "TH Antibody - N-terminal region : FITC (AVARP01052_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TH Antibody - N-terminal region : FITC (AVARP01052_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TH Antibody - N-terminal region : FITC (AVARP01052_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TH Antibody - N-terminal region : FITC (AVARP01052_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TH"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TH"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TH"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TH"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TH Antibody - N-terminal region : FITC (AVARP01052_P050-FITC)
Your Rating
We found other products you might like!