Size:100 ul
$229.00
In Stock
SKU
ARP36141_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP36141_T100-FITC Conjugated

ARP36141_T100-HRP Conjugated

ARP36141_T100-Biotin Conjugated

TGIF2LY Antibody - middle region (ARP36141_T100)

Catalog#: ARP36141_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human, Yeast
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-91539 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TGIF2LY
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Human: 100%; Yeast: 90%
Complete computational species homology data Anti-TGIF2LY (ARP36141_T100)
Peptide Sequence Synthetic peptide located within the following region: NWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-TGIF2LY (ARP36141_T100) antibody is Catalog # AAP36141 (Previous Catalog # AAPP08928)
Datasheets/Manuals Printable datasheet for anti-TGIF2LY (ARP36141_T100) antibody
Target Reference Skaletsky,H., (2003) Nature 423 (6942), 825-837
Gene Symbol TGIF2LY
Official Gene Full Name TGFB-induced factor homeobox 2-like, Y-linked
Alias Symbols TGIFLY
NCBI Gene Id 90655
Protein Name Homeobox protein TGIF2LY
Description of Target TGIF2LY is a member of the TALE/TGIF homeobox family of transcription factors. This gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. The C-terminus of this protein is divergent from that of its chromosome X homolog (TGIF2LX), suggesting that this protein may act as a regulator of TGIF2LX.This gene encodes a member of the TALE/TGIF homeobox family of transcription factors. This gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. The C-terminus of this protein is divergent from that of its chromosome X homolog (TGIF2LX), suggesting that this protein may act as a regulator of TGIF2LX.
Swissprot Id Q8IUE0
Protein Accession # NP_631960
Nucleotide Accession # NM_139214
Protein Size (# AA) 185
Molecular Weight 21kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TGIF2LY.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TGIF2LY.
Protein Interactions MBIP; NAB2; YWHAQ; PCBD2;
  1. What is the species homology for "TGIF2LY Antibody - middle region (ARP36141_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Yeast".

  2. How long will it take to receive "TGIF2LY Antibody - middle region (ARP36141_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TGIF2LY Antibody - middle region (ARP36141_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TGIF2LY Antibody - middle region (ARP36141_T100)"?

    This target may also be called "TGIFLY" in publications.

  5. What is the shipping cost for "TGIF2LY Antibody - middle region (ARP36141_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TGIF2LY Antibody - middle region (ARP36141_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TGIF2LY Antibody - middle region (ARP36141_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "21kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TGIF2LY Antibody - middle region (ARP36141_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "TGIF2LY"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TGIF2LY"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TGIF2LY"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TGIF2LY"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TGIF2LY"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TGIF2LY"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TGIF2LY Antibody - middle region (ARP36141_T100)
Your Rating