Search Antibody, Protein, and ELISA Kit Solutions

TGIF2LY Antibody - middle region (ARP36141_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP36141_T100-FITC Conjugated

ARP36141_T100-HRP Conjugated

ARP36141_T100-Biotin Conjugated

Gene Symbol:
TGIF2LY
Official Gene Full Name:
TGFB-induced factor homeobox 2-like, Y-linked
NCBI Gene Id:
90655
Protein Name:
Homeobox protein TGIF2LY
Swissprot Id:
Q8IUE0
Protein Accession #:
NP_631960
Nucleotide Accession #:
NM_139214
Alias Symbols:
TGIFLY
Replacement Item:
This antibody may replace item sc-91539 from Santa Cruz Biotechnology.
Description of Target:
TGIF2LY is a member of the TALE/TGIF homeobox family of transcription factors. This gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. The C-terminus of this protein is divergent from that of its chromosome X homolog (TGIF2LX), suggesting that this protein may act as a regulator of TGIF2LX.This gene encodes a member of the TALE/TGIF homeobox family of transcription factors. This gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. The C-terminus of this protein is divergent from that of its chromosome X homolog (TGIF2LX), suggesting that this protein may act as a regulator of TGIF2LX.
Protein Size (# AA):
185
Molecular Weight:
21kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TGIF2LY.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TGIF2LY.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human TGIF2LY
Predicted Species Reactivity:
Human, Yeast
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Yeast: 90%
Complete computational species homology data:
Anti-TGIF2LY (ARP36141_T100)
Peptide Sequence:
Synthetic peptide located within the following region: NWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MBIP; NAB2; YWHAQ; PCBD2;
Blocking Peptide:
For anti-TGIF2LY (ARP36141_T100) antibody is Catalog # AAP36141 (Previous Catalog # AAPP08928)
Datasheets/Manuals:
Printable datasheet for anti-TGIF2LY (ARP36141_T100) antibody
Target Reference:
Skaletsky,H., (2003) Nature 423 (6942), 825-837

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...