- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-TGFBR2 (OAAN00346) |
---|
Predicted Species Reactivity | Human, Mouse, Rat |
---|---|
Product Format | Liquid. PBS with 0.02% sodium azide, 50% glycerol, pH 7.3 |
Clonality | Polyclonal |
Isotype | IgG |
Host | Rabbit |
Application | WB, IHC |
Additional Information | Positive samples: HT-29, A549, Mouse lung, Mouse spleen, Mouse brain, Mouse kidney, Rat lung Cellular location: Cell membrane, Single-pass type I membrane protein |
Reconstitution and Storage | Store at -20C. Avoid repeated freeze/thaw cycles. |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 23-280 of human TGFBR2 |
Purification | Affinity purified |
Application Info | WB: 1:500 - 1:2,000 IHC: 1:50 - 1:200 |
Protein Sequence | TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFP |
Gene Symbol | TGFBR2 |
---|---|
Gene Full Name | transforming growth factor beta receptor 2 |
Alias Symbols | AAT3, FAA3, LDS2, MFS2, RIIC, LDS1B, LDS2B, TAAD2, TBRII, TBR-ii, TGFR-2, TGFbeta-RII |
NCBI Gene Id | 7048 |
Protein Name | TGF-beta receptor type-2 |
Description of Target | This gene encodes a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. The encoded protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different isoforms have been characterized. |
Uniprot ID | P37173 |
Protein Accession # | NP_001020018.1 |
Nucleotide Accession # | NM_001024847.2 |
Molecular Weight | 64 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "TGFBR2 Antibody (OAAN00346)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat".
-
How long will it take to receive "TGFBR2 Antibody (OAAN00346)"?
This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".
-
What buffer format is "TGFBR2 Antibody (OAAN00346)" provided in?
This item is provided in "Liquid. PBS with 0.02% sodium azide, 50% glycerol, pH 7.3".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "TGFBR2 Antibody (OAAN00346)"?
This target may also be called "AAT3, FAA3, LDS2, MFS2, RIIC, LDS1B, LDS2B, TAAD2, TBRII, TBR-ii, TGFR-2, TGFbeta-RII" in publications.
-
What is the shipping cost for "TGFBR2 Antibody (OAAN00346)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "TGFBR2 Antibody (OAAN00346)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "TGFBR2 Antibody (OAAN00346)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "64 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "TGFBR2 Antibody (OAAN00346)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "TGFBR2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "TGFBR2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "TGFBR2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "TGFBR2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "TGFBR2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "TGFBR2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.