Size:100 ul
$319.00
In stock
SKU
ARP45446_P050-HRP
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45446_P050 Unconjugated

ARP45446_P050-FITC Conjugated

ARP45446_P050-Biotin Conjugated

TGFB2 Antibody - middle region : HRP (ARP45446_P050-HRP)

Catalog#: ARP45446_P050-HRP
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality Polyclonal
Host Rabbit
Conjugation HRP
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-124019 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TGFB2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Complete computational species homology data Anti-TGFB2 (ARP45446_P050)
Peptide Sequence Synthetic peptide located within the following region: NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT
Concentration 0.5 mg/ml
Blocking Peptide For anti-TGFB2 (ARP45446_P050-HRP) antibody is Catalog # AAP45446 (Previous Catalog # AAPP26515)
Datasheets/Manuals Printable datasheet for anti-TGFB2 (ARP45446_P050-HRP) antibody
Sample Type Confirmation

There is BioGPS gene expression data showing that TGFB2 is expressed in NCIH226

Gene Symbol TGFB2
Official Gene Full Name Transforming growth factor, beta 2
Alias Symbols MGC116892, TGF-beta2
NCBI Gene Id 7042
Protein Name Transforming growth factor beta-2
Description of Target This gene encodes a member of the transforming growth factor beta (TGFB) family of cytokines, which are multifunctional peptides that regulate proliferation, differentiation, adhesion, migration, and other functions in many cell types by transducing their signal through combinations of transmembrane type I and type II receptors (TGFBR1 and TGFBR2) and their downstream effectors, the SMAD proteins. Disruption of the TGFB/SMAD pathway has been implicated in a variety of human cancers. The encoded protein is secreted and has suppressive effects of interleukin-2 dependent T-cell growth. Translocation t(1;7)(q41;p21) between this gene and HDAC9 is associated with Peters' anomaly, a congenital defect of the anterior chamber of the eye. The knockout mice lacking this gene show perinatal mortality and a wide range of developmental, including cardiac, defects. Alternatively spliced transcript variants encoding different isoforms have been identified.
Swissprot Id P61812
Protein Accession # NP_003229
Nucleotide Accession # NM_003238
Protein Size (# AA) 414
Molecular Weight 46kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TGFB2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TGFB2.
Protein Interactions CEBPA; UBC; VASN; PZP; LTBP3; TGFBR3; FMOD; VTN; TGFB3; TGFB2; TGFBR2; TGFBR1; TGFB1; ENG; CTGF; BMP2; APP; TGFBRAP1; DAXX; DCN;
Write Your Own Review
You're reviewing:TGFB2 Antibody - middle region : HRP (ARP45446_P050-HRP)
Your Rating