SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP45446_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP45446_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

TGFB2 Antibody - middle region : Biotin (ARP45446_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-TGFB2 (ARP45446_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TGFB2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT
Concentration0.5 mg/ml
Blocking PeptideFor anti-TGFB2 (ARP45446_P050-Biotin) antibody is Catalog # AAP45446 (Previous Catalog # AAPP26515)
Sample Type Confirmation

There is BioGPS gene expression data showing that TGFB2 is expressed in NCIH226

Gene SymbolTGFB2
Gene Full NameTransforming growth factor, beta 2
Alias SymbolsLDS4, G-TSF, TGF-beta2
NCBI Gene Id7042
Protein NameTransforming growth factor beta-2
Description of TargetThis gene encodes a member of the transforming growth factor beta (TGFB) family of cytokines, which are multifunctional peptides that regulate proliferation, differentiation, adhesion, migration, and other functions in many cell types by transducing their signal through combinations of transmembrane type I and type II receptors (TGFBR1 and TGFBR2) and their downstream effectors, the SMAD proteins. Disruption of the TGFB/SMAD pathway has been implicated in a variety of human cancers. The encoded protein is secreted and has suppressive effects of interleukin-2 dependent T-cell growth. Translocation t(1;7)(q41;p21) between this gene and HDAC9 is associated with Peters' anomaly, a congenital defect of the anterior chamber of the eye. The knockout mice lacking this gene show perinatal mortality and a wide range of developmental, including cardiac, defects. Alternatively spliced transcript variants encoding different isoforms have been identified.
Uniprot IDP61812
Protein Accession #NP_003229
Nucleotide Accession #NM_003238
Protein Size (# AA)414
Molecular Weight46kDa
Protein InteractionsCEBPA; UBC; VASN; PZP; LTBP3; TGFBR3; FMOD; VTN; TGFB3; TGFB2; TGFBR2; TGFBR1; TGFB1; ENG; CTGF; BMP2; APP; TGFBRAP1; DAXX; DCN;
  1. What is the species homology for "TGFB2 Antibody - middle region : Biotin (ARP45446_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "TGFB2 Antibody - middle region : Biotin (ARP45446_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TGFB2 Antibody - middle region : Biotin (ARP45446_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TGFB2 Antibody - middle region : Biotin (ARP45446_P050-Biotin)"?

    This target may also be called "LDS4, G-TSF, TGF-beta2" in publications.

  5. What is the shipping cost for "TGFB2 Antibody - middle region : Biotin (ARP45446_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TGFB2 Antibody - middle region : Biotin (ARP45446_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TGFB2 Antibody - middle region : Biotin (ARP45446_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TGFB2 Antibody - middle region : Biotin (ARP45446_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TGFB2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TGFB2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TGFB2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TGFB2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TGFB2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TGFB2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TGFB2 Antibody - middle region : Biotin (ARP45446_P050-Biotin)
Your Rating
We found other products you might like!