Search Antibody, Protein, and ELISA Kit Solutions

TGFB2 Antibody - middle region (ARP45446_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45446_P050-FITC Conjugated

ARP45446_P050-HRP Conjugated

ARP45446_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Transforming growth factor, beta 2
NCBI Gene Id:
Protein Name:
Transforming growth factor beta-2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MGC116892, TGF-beta2
Replacement Item:
This antibody may replace item sc-124019 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the transforming growth factor beta (TGFB) family of cytokines, which are multifunctional peptides that regulate proliferation, differentiation, adhesion, migration, and other functions in many cell types by transducing their signal through combinations of transmembrane type I and type II receptors (TGFBR1 and TGFBR2) and their downstream effectors, the SMAD proteins. Disruption of the TGFB/SMAD pathway has been implicated in a variety of human cancers. The encoded protein is secreted and has suppressive effects of interleukin-2 dependent T-cell growth. Translocation t(1;7)(q41;p21) between this gene and HDAC9 is associated with Peters' anomaly, a congenital defect of the anterior chamber of the eye. The knockout mice lacking this gene show perinatal mortality and a wide range of developmental, including cardiac, defects. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TGFB2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TGFB2.
The immunogen is a synthetic peptide directed towards the middle region of human TGFB2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-TGFB2 (ARP45446_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-TGFB2 (ARP45446_P050) antibody is Catalog # AAP45446 (Previous Catalog # AAPP26515)
Printable datasheet for anti-TGFB2 (ARP45446_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that TGFB2 is expressed in NCIH226

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...