TGFB1 Recombinant Protein (African clawed frog) (OPCA03225)

Catalog No: OPCA03225

tgfb1 Recombinant Protein (Xenopus laevis) (OPCA03225) in SDS-PAGE showing the molecular weight of approximately 28.63 kDa.

Product Info

• Predicted Species Reactivity: Xenopus laevis
• Product Format: Liquid or Lyophilized powder
• Host: Xenopus laevis
• Additional Information: Relevance: Important role in certain aspects of differentiation.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: GVGQEYCFGNNGPNCCVKPLYINFRKDLGWKWIHEPKGYEANYCLGNCPYIWSMDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIYYVGRTAKVEQLSNMVVRSCNCS
• Protein Sequence: GVGQEYCFGNNGPNCCVKPLYINFRKDLGWKWIHEPKGYEANYCLGNCPYIWSMDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIYYVGRTAKVEQLSNMVVRSCNCS
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 271-382 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: Identification of a novel transforming growth factor-beta (TGF-beta 5) mRNA in Xenopus laevis.Kondaiah P., Sands M.J., Smith J.M., Fields A., Roberts A.B., Sporn M.B., Melton D.A.J. Biol. Chem. 265:1089-1093(1990)
• Gene Symbol: tgfb1.L
• Gene Full Name: transforming growth factor beta 1 L homeolog
• Alias Symbols: ced;dpd1;lap;tgf beta;tgfb;tgfb1;tgfb5;tgfbeta;tgf-beta;tgf-beta 5;TGF-beta-1;TGF-beta5;TGF-beta-5;transforming gorwth factor-Beta5;transforming growth factor beta-1 proprotein;transforming growth factor-B5;transforming growth factor-beta 5 (TGF-beta 5);XELAEV_18039344mg.
• NCBI Gene Id: 397778
• Protein Name: Transforming growth factor beta-1
• Description of Target: Important role in certain aspects of differentiation.
• Uniprot ID: P16176
• Protein Accession #: NP_001081330.1
  
• Nucleotide Accession #: NM_001087861.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 28.6 kDa