TG Recombinant Protein (Rat) (OPCA04433)

Catalog No: OPCA04433

Product Info

• Predicted Species Reactivity: Rat|Rattus norvegicus
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Rattus norvegicus (Rat)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: NIFEYQVDAQPLRPCELQREKAFLKQDEYVPQCSEDGSFQTVQCQNDGQSCWCVDSDGTEVPGSRQLGRPTACLSFCQLHKQRILLSSYINSTDALYLPQCQDSGNYAPVQCDLQQVQCWCVDTEGMEVYGTRQQGRPTRCPRSCEIRSRRLLHGVGDKSPPQCDADGEFMPVQCKFVNTTDMMIFDLIHNYNRFPDAFVTFSAFRNRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDQASTFTQSTMYRILQRRFLAIQLVISGRFRCPT
• Protein Sequence: NIFEYQVDAQPLRPCELQREKAFLKQDEYVPQCSEDGSFQTVQCQNDGQSCWCVDSDGTEVPGSRQLGRPTACLSFCQLHKQRILLSSYINSTDALYLPQCQDSGNYAPVQCDLQQVQCWCVDTEGMEVYGTRQQGRPTRCPRSCEIRSRRLLHGVGDKSPPQCDADGEFMPVQCKFVNTTDMMIFDLIHNYNRFPDAFVTFSAFRNRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDQASTFTQSTMYRILQRRFLAIQLVISGRFRCPT
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 21-300 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: A novel missense mutation (G2320R) in thyroglobulin causes hypothyroidism in rdw rats.Hishinuma A., Furudate S., Oh-Ishi M., Nagakubo N., Namatame T., Ieiri T.Endocrinology 141:4050-4055(2000).
• Gene Symbol: TG
• Alias Symbols: Tg
• Protein Name: Thyroglobulin
• Description of Target: Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3).
• Uniprot ID: P06882
• Protein Size (# AA): Recombinant
• Molecular Weight: 48 kDa