TFPI Antibody - middle region (ARP63092_P050)

Catalog No: ARP63092_P050

WB Suggested Anti-TFPI Antibody
Titration: 1.0 ug/ml
Positive Control: 721_B Whole Cell

Rabbit Anti-TFPI Antibody
Catalog Number: ARP63092_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Cytoplasmic in secretory granules
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 77%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: QEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TFPI (ARP63092_P050) antibody is Catalog # AAP63092

Target Info

• Gene Symbol: TFPI
• Gene Full Name: Tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor)
• Alias Symbols: EPI, TFI, LACI, TFPI1
• NCBI Gene Id: 7035
• Protein Name: Tissue factor pathway inhibitor
• Description of Target: This gene encodes a protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates with the formation of a factor VIIa-TF complex, which proteolytically activates additional proteases (factors IX and X) and ultimately leads to the formation of a fibrin clot. The product of this gene inhibits the activated factor X and VIIa-TF proteases in an autoregulatory loop. The encoded protein is glycosylated and predominantly found in the vascular endothelium and plasma in both free forms and complexed with plasma lipoproteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been confirmed.
• Uniprot ID: P10646
• Protein Accession #: NP_006278
• Nucleotide Accession #: NM_006287
• Protein Size (# AA): 304
• Molecular Weight: 33kDa
• Protein Interactions: SMU1; SF3B1; BCAS2; SAP18; SRSF11; SON; SRSF7; APP; ELAVL1; PRSS3; MMP12; F10; THBS1; MMP7; ELANE; MMP9; MMP8; MMP1;