SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP63092_P050
Price: $0.00
SKU
ARP63092_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TFPI (ARP63092_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 77%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: QEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETL
Concentration0.5 mg/ml
Blocking PeptideFor anti-TFPI (ARP63092_P050) antibody is Catalog # AAP63092
Gene SymbolTFPI
Gene Full NameTissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor)
Alias SymbolsEPI, TFI, LACI, TFPI1
NCBI Gene Id7035
Protein NameTissue factor pathway inhibitor
Description of TargetThis gene encodes a protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates with the formation of a factor VIIa-TF complex, which proteolytically activates additional proteases (factors IX and X) and ultimately leads to the formation of a fibrin clot. The product of this gene inhibits the activated factor X and VIIa-TF proteases in an autoregulatory loop. The encoded protein is glycosylated and predominantly found in the vascular endothelium and plasma in both free forms and complexed with plasma lipoproteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been confirmed.
Uniprot IDP10646
Protein Accession #NP_006278
Nucleotide Accession #NM_006287
Protein Size (# AA)304
Molecular Weight33kDa
Protein InteractionsSMU1; SF3B1; BCAS2; SAP18; SRSF11; SON; SRSF7; APP; ELAVL1; PRSS3; MMP12; F10; THBS1; MMP7; ELANE; MMP9; MMP8; MMP1;
  1. What is the species homology for "TFPI Antibody - middle region (ARP63092_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "TFPI Antibody - middle region (ARP63092_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TFPI Antibody - middle region (ARP63092_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TFPI Antibody - middle region (ARP63092_P050)"?

    This target may also be called "EPI, TFI, LACI, TFPI1" in publications.

  5. What is the shipping cost for "TFPI Antibody - middle region (ARP63092_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TFPI Antibody - middle region (ARP63092_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TFPI Antibody - middle region (ARP63092_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TFPI Antibody - middle region (ARP63092_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TFPI"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TFPI"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TFPI"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TFPI"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TFPI"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TFPI"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TFPI Antibody - middle region (ARP63092_P050)
Your Rating
We found other products you might like!