TFDP1 Antibody - middle region (P100879_P050)

Catalog No: P100879_P050

WB Suggested Anti-TFDP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: COLO205 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Cow, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TFDP1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Human: 100%; Mouse: 100%; Zebrafish: 84%
• Peptide Sequence: Synthetic peptide located within the following region: FSASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDEEDDDFNENDE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TFDP1 (P100879_P050) antibody is Catalog # AAP31169 (Previous Catalog # AAPP01912)

Target Info

• Reference: Datta,A., (2005) Mol. Cell. Biol. 25 (18), 8024-8036
• Gene Symbol: TFDP1
• Gene Full Name: Transcription factor Dp-1
• Alias Symbols: DP1, DILC, Dp-1, DRTF1
• NCBI Gene Id: 7027
• Protein Name: Transcription factor Dp-1
• Description of Target: The E2F transcription factor family regulates the expression of various cellular promoters, particularly those involved in the cell cycle. E2F factors bind to DNA as homodimers or heterodimers in association with dimerization partner DP1. TFDP1 may be the first example of a family of related transcription factors and may have a role in progression of some hepatocellular carcinomas by promoting growth of the tumor cells. The E2F transcription factor family (see MIM 189971) regulates the expression of various cellular promoters, particularly those involved in the cell cycle. E2F factors bind to DNA as homodimers or heterodimers in association with dimerization partner DP1. TFDP1 may be the first example of a family of related transcription factors; see TFDP2 (MIM 602160).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q14186
• Protein Accession #: NP_009042
• Nucleotide Accession #: NM_007111
• Protein Size (# AA): 410
• Molecular Weight: 45kDa
• Protein Interactions: UBC; E2F6; E2F4; SIAH1; E2F3; E2F2; E2F1; CDK6; PRPF31; CDK2; CDK1; SOCS3; RB1; PCGF6; RYBP; YAF2; RNF2; ELAVL1; LIN9; LIN54; LIN37; RBL2; SERTAD2; NPDC1; E2F5; TP53; RBL1; CDK3; TP53BP1;