Catalog No: AVARP09052_P050
Price: $0.00
SKU
AVARP09052_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TFDP1 (AVARP09052_P050) antibody
Product Info
ReferenceDatta,A., (2005) Mol. Cell. Biol. 25 (18), 8024-8036
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Cow, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TFDP1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Human: 100%; Mouse: 100%; Zebrafish: 85%
Peptide SequenceSynthetic peptide located within the following region: SASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDEEDDDFNENDED
Concentration0.5 mg/ml
Blocking PeptideFor anti-TFDP1 (AVARP09052_P050) antibody is Catalog # AAP30618 (Previous Catalog # AAPP01271)
Gene SymbolTFDP1
Gene Full NameTranscription factor Dp-1
Alias SymbolsDP1, DILC, Dp-1, DRTF1
NCBI Gene Id7027
Protein NameTranscription factor Dp-1
Description of TargetThe E2F transcription factor family regulates the expression of various cellular promoters, particularly those involved in the cell cycle. E2F factors bind to DNA as homodimers or heterodimers in association with dimerization partner DP1. TFDP1 may be the first example of a family of related transcription factors and may have a role in progression of some hepatocellular carcinomas by promoting growth of the tumor cells. The E2F transcription factor family (see MIM 189971) regulates the expression of various cellular promoters, particularly those involved in the cell cycle. E2F factors bind to DNA as homodimers or heterodimers in association with dimerization partner DP1. TFDP1 may be the first example of a family of related transcription factors; see TFDP2 (MIM 602160).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ14186
Protein Accession #NP_009042
Nucleotide Accession #NM_007111
Protein Size (# AA)410
Molecular Weight45kDa
Protein InteractionsUBC; E2F6; E2F4; SIAH1; E2F3; E2F2; E2F1; CDK6; PRPF31; CDK2; CDK1; SOCS3; RB1; PCGF6; RYBP; YAF2; RNF2; ELAVL1; LIN9; LIN54; LIN37; RBL2; SERTAD2; NPDC1; E2F5; TP53; RBL1; CDK3; TP53BP1;
  1. What is the species homology for "TFDP1 Antibody - middle region (AVARP09052_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Cow, Zebrafish".

  2. How long will it take to receive "TFDP1 Antibody - middle region (AVARP09052_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TFDP1 Antibody - middle region (AVARP09052_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TFDP1 Antibody - middle region (AVARP09052_P050)"?

    This target may also be called "DP1, DILC, Dp-1, DRTF1" in publications.

  5. What is the shipping cost for "TFDP1 Antibody - middle region (AVARP09052_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TFDP1 Antibody - middle region (AVARP09052_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TFDP1 Antibody - middle region (AVARP09052_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TFDP1 Antibody - middle region (AVARP09052_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TFDP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TFDP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TFDP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TFDP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TFDP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TFDP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TFDP1 Antibody - middle region (AVARP09052_P050)
Your Rating
We found other products you might like!