Search Antibody, Protein, and ELISA Kit Solutions

TFAP4 Antibody - C-terminal region (ARP33436_T100)

100 ul

Regular Price: $249.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP33436_T100-FITC Conjugated

ARP33436_T100-HRP Conjugated

ARP33436_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
TFAP4
Official Gene Full Name:
Transcription factor AP-4 (activating enhancer binding protein 4)
NCBI Gene Id:
7023
Protein Name:
Transcription factor AP-4
Swissprot Id:
Q01664
Protein Accession #:
NP_003214
Nucleotide Accession #:
NM_003223
Alias Symbols:
AP-4, bHLHc41
Replacement Item:
This antibody may replace item sc-166024 from Santa Cruz Biotechnology.
Description of Target:
Enhancer binding protein TFAP4 is a transcription factor that activates both viral and cellular genes by binding to the symmetrical DNA sequence, CAGCTG.
Protein Size (# AA):
338
Molecular Weight:
39kDa
Purification:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TFAP4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TFAP4.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human TFAP4
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 93%
Complete computational species homology data:
Anti-TFAP4 (ARP33436_T100)
Peptide Sequence:
Synthetic peptide located within the following region: EEEQRRAVIVKPVRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
GOLGA2; TRAF1; FBXW11; EXOSC8; BTRC; CUL1; UBC; SKP1; SRP54; XRCC5; SP1; SOGA3; INO80E; ARID2; DNTTIP1; UHRF2; ELMSAN1; NAV3; EHMT1; SAP130; PRDM16; ZNF335; WIZ; ZNF462; MTA3; YEATS2; PPP6R3; C4orf27; TERF2IP; CHRAC1; ZBTB7A; ZBTB7B; TFCP2L1; BRD7; THYN1;
Blocking Peptide:
For anti-TFAP4 (ARP33436_T100) antibody is Catalog # AAP33436 (Previous Catalog # AAPP04482)
Datasheets/Manuals:
Printable datasheet for anti-TFAP4 (ARP33436_T100) antibody
Target Reference:
Petersenn,S., et al., (1998) Mol. Endocrinol. 12 (2), 233-247

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...